Accessory component of the proton-transporting vacuolar (V)-ATPase protein pump involved in intracellular iron homeostasis. In aerobic conditions, required for intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. Necessary for endolysosomal acidification and lysosomal degradation (By similarity). May be involved in Golgi homeostasis (By similarity).

208 amino acids

MASSLLAGERLVRALGPGGELEREQLPRKLRAQLEAALGKKHAGSDNATGPRRLVSFRLIRDLHQHLRERNSRLYLHELLEGSDIYFPEIVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDAQCGGTLSDLGKQVRSVKALVVTIFNFIITVAAAFVCTYLGSQYVFTEMASRVLAALIVASVVGLAELYVMVRAMEGELGEL

23.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Tmem199 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here