Timm21

Mitochondrial import inner membrane translocase subunit Tim21

249 amino acids

Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes.

Belongs to the TIM21 family.

28.304 kDa

MICAFLRVVQHAEKLHGSLGRQLLPHFVFTKACFKTQPLRWGLREQKITVQPRTVLRFTQKTFWTQGPDPRKAKEDSTKQVSIRRNQREETGVSMSQKVREAGRDVSYLIVVLFGVGLTGGLLYAIFKELFFSSSPNIIYGKALGKCRTHPEVSFLMIVLGRRCASLLKPMLSCFSVFRSHSLMHFDPGTVSYIHFSVVLSAPASSGLRHPSYKTILNQNVAKRVESWQRLHLGHYIVYRIQGILCGPQ

TIMM21

Mitochondrial import inner membrane translocase subunit Tim21

248 amino acids

Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes.

Belongs to the TIM21 family.

28.202 kDa

MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD

Timm21

Mitochondrial import inner membrane translocase subunit Tim21

245 amino acids

Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes.

Belongs to the TIM21 family.

27.876 kDa

MICAFLRVVRHAEKLHGSLGRQLLLPHFVLTKACLKTQPLRWGLREQKKTVQPRTVLGFTQKTFWTQGPDPRKAKEDSSKQVSINRNQREETGVSTSQKVKEAGRDVTYLIVVLFGVSITGSLLYTIFKELFSSSSPNIIYGKALGKCRTHPEVISVFGEPVKGYGEMSRRGRRQHVSFTEYANNGLKRIRVKFYIEGSEPGKQGTVHAEVEENPRSGQFDFRYIFVDVAPKRSIVVEDNRFQQS

TIMM21

Mitochondrial import inner membrane translocase subunit Tim21

244 amino acids

Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes.

Belongs to the TIM21 family.

27.938 kDa

MICTLLRAVRCTERLHGCPGKPWFLPHSVPHRACSQTEPRWRWGLQEQNTTARPRCIWGVTQRSIWTQVRSPQSAKEDGSKQVSVHRSQGGETVLSTSQKVKEAGRDFTYLIVVLIGISITGGLFYTIFRELFSSSSPNKIYGKALEKCRSHPEVISVFGEPVKGYGEVTRRGRRQLVSFIEYKKDGLKHMRVKFYIQGSEPGKQGTVHLEVKENPESGEYEFRYIFVELEPYSRTIVVEDNRS

timm21

Mitochondrial import inner membrane translocase subunit Tim21

232 amino acids

May participate in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Belongs to the TIM21 family.

26.066 kDa

MLPRFLWRPVLCSYRALGSPSRSLTVSYRNLSCLALLHKGAFAAPTSRSLFCAERPISTGCTSLQVKDKRVSVQSTSDGAPPQNASHKVKEAGRDFTYFIVVLIGIGVTGGLFYVVFEELFSSSSPSKIYGEALEKCRSHPEVIGAFGEPIKGYGETTRRGRRQHVSHMEFVKDGIKCMRLKFYIEGSEPRKQGTVHIEVKENPASGKYEFQYIFVEIDTYPRRTIIIEDNR

TIMM21

Mitochondrial import inner membrane translocase subunit Tim21

172 amino acids

Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes.

Belongs to the TIM21 family.

19.287 kDa

MICTFLRAVQYTEKLHRSLAKRLLLPHIVLNKACLKTEPSLRCRLQYQKKTVLPRCILGVTQKTIWTQGPSPGKAKEDSSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEGRSSHRPRSDVIARICSP