Protein expression services for Timm21 | Mitochondrial import inner membrane translocase subunit Tim21
Description
Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes.
Family
Belongs to the TIM21 family.
Species
Rattus norvegicus
Length
245 amino acids
Sequence
MICAFLRVVRHAEKLHGSLGRQLLLPHFVLTKACLKTQPLRWGLREQKKTVQPRTVLGFTQKTFWTQGPDPRKAKEDSSKQVSINRNQREETGVSTSQKVKEAGRDVTYLIVVLFGVSITGSLLYTIFKELFSSSSPNIIYGKALGKCRTHPEVISVFGEPVKGYGEMSRRGRRQHVSFTEYANNGLKRIRVKFYIEGSEPGKQGTVHAEVEENPRSGQFDFRYIFVDVAPKRSIVVEDNRFQQS
Mass
27.9 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Timm21 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here