tim13

Mitochondrial import inner membrane translocase subunit tim13

113 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

12.089 kDa

MAIWGSSSSNTASSGEADIKTHLMNQVRQEAAVTNARNLIGKVNEHCFEACIPNPGTSLSSAEHTCLSQCMEKYISFWNAVSRGYIARLANERKAYGGGALDASFVQSGESSL

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

108 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

12.086 kDa

MAFWNSSSSSSSSGQTDSSSTSSPASLRSQQIKQDLQNQISQELAAANATELVRTITENCFDKCILIPKDTLSPTELQCISQCREKYMRSWNVISKAYIGRIQQEQHH

tim13

Mitochondrial import inner membrane translocase subunit tim13

108 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

11.313 kDa

MALFGSSAPAAAAPANSAEDVQQTKANLIAQLQQEMAMANAKKLISKVNQNCFENCITAPGSSLSASESTCLSSCMEKYIQFWNAASKAYIARATTQTVAANAMATEL

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

105 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

11.069 kDa

MDLSSLTGKSAAAGGATSAERKEAIKQQVSSELAMANAQQLITKATEKCYSKCIPAPGASLSGKEQTCLTRCMERYFEAFNIVSSTYVRRVSNERAAGAVAEAGL

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

105 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins under precise conditions while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins. Strictly required for import of TIM23 in some conditions, when a low membrane potential exists in the mitochondria.

Belongs to the small Tim family.

11.286 kDa

MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELVNKISENCFEKCLTSPYATRNDACIDQCLAKYMRSWNVISKAYISRIQNASASGEI

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

103 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.996 kDa

MALSSIFGGGSPSQQSNLPTSSASSSVKDQLKGQIAQELAVANATELVNKVTENCFEKCLMAPYTSKQDTCVDQCLAKYMRSWNAISQAYVARIQQASANGDI

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

101 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.797 kDa

MALTSIFGGSSSSSGTPATSSPSDVKTQLKSQISQELAIANATELVNKVTENCFEKCLNAPYAASQDNCVDQCLAKYMRSWNAISKAYINRIQQASVNGEI

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

99 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.721 kDa

MSSFFGSGAGSPSNDMTARKEQMKQSIQQELAIANAQQLINKINENCFAKCVTKPSTSLSSSQESCLSQCMTLYMAAFDQVSRSYVARISKERGVAPGL

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

99 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.721 kDa

MSSFFGSGAGSPSNDMTARKEQMKQSIQQELAIANAQQLINKINENCFAKCVTKPSTSLSSSQESCLSQCMTLYMAAFDQVSRSYVARISKERGVAPGL

TIM13

Mitochondrial import inner membrane translocase subunit Tim13

98 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex mediates the import of some proteins while the predominant TIM9-TIM0 70 kDa complex mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

11.089 kDa

MEQILDVESLKKLTPEQQKTLISGVKQQAAILTAQNMITDXSERCLTKCITXPGSALSXTERQCLQRCMDRFMETYXLASQXLQNRVXEEIAAXTRMT

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

98 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.909 kDa

MAFFGTPSTSTSTGTTSGQSQQVKQQIQEQISQELAVANATELVNKITENCFEKCVEQPQNGLNPQQDACVNQCLEKYMRSWNVVSKSYITRIQQSSN

tim13

Mitochondrial import inner membrane translocase subunit tim13

95 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.742 kDa

MGIFGGNSGNAPSSEDKKSIFMKQIRQELAVAQAGELISKINENCFDKCIPEPGSTFDPNEKSCVSKCMERYMDAWNIVSRTYISRMQREQKNLN

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

95 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.342 kDa

MALFGGSSSQAPASATDNKVQAFKQQIAQEIAVANATDLVNKVSENCFEKCLQSPYKDGNEGCVDQCLAKYMRSWNVISKTYINRIQDASTTGEI

Tim13

Mitochondrial import inner membrane translocase subunit Tim13

92 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The Tim8-Tim13 complex mediates the import of some proteins while the predominant Tim9-Tim10 70 kDa complex mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.693 kDa

MAAANMEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSRTYGNRLQREQYRTMESLEMTS

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex mediates the import of some proteins while the predominant TIM9-TIM10 70 kDa complex mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

9.412 kDa

MDSYSSPPMGGSGSSVSPEVMMESVKTQLAQAYAEELIETLRTKCFDKCVTKPGSSLGGSESSCISRCVERYMEATAIISRSLFTQR

tim13

Mitochondrial import inner membrane translocase subunit tim13

86 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The tim8-tim13 complex is non essential and only mediates the import of few proteins, while the predominant tim9-tim10 70 kDa complex is crucial and mediates the import of much more proteins.

Belongs to the small Tim family.

9.568 kDa

MSDSTSETVKKAIIKQVLIESQSANARTLMEKIGENCFTSCVPKPGSSLSNSEKTCVTQCTEKYMAAWNVVNTTYLRRIQQEMGNQ

TIM13

Mitochondrial import inner membrane translocase subunit Tim13

84 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex mediates the import of some proteins while the predominant TIM9-TIM10 70 kDa complex mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

8.936 kDa

MDSFSSSSGSPPNTEALMDQIKAQLAQAYAQEFLETVGNKCFAKCVTKPGSSLSGSESSCISRCVDRYIEATGIVSRALFSSTR

TIM13

Mitochondrial import inner membrane translocase subunit TIM13

82 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

9.116 kDa

MDSTQVKAAVIKQVQQEANLVNARTLIEKLQETCFEKCVPKPGTSLSSGETTCMTSCMEKYMAAWNMVNSAYIARLRQESGH