About Products Protein Database Contact

Protein expression services for TIM13 | Mitochondrial import inner membrane translocase subunit Tim13

Description
Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex mediates the import of some proteins while the predominant TIM9-TIM10 70 kDa complex mediates the import of much more proteins (By similarity).
Family
Belongs to the small Tim family.
Species
Oryza sativa subsp. japonica
Length
84 amino acids
Sequence
MDSFSSSSGSPPNTEALMDQIKAQLAQAYAQEFLETVGNKCFAKCVTKPGSSLSGSESSCISRCVDRYIEATGIVSRALFSSTR
Mass
8.9 kDa
Simulated SDS-PAGE
Western blot of TIM13 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make TIM13 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here