TIM10

Mitochondrial import inner membrane translocase subunit TIM10

140 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

15.622 kDa

MSFLGLGGQNPNGPSNPQKLLAAEAELDMVTDMFNRLVESCHEKCIKADYSSGDLNANEGLCLDRCVAKYFDVNTKVGEVSMRGADGNYGLEDTANTVHAEAWKQRILHGPTLNVKYVHRIKVHEIVRLTMVYLAPWHFN

TIM10

Mitochondrial import inner membrane translocase subunit TIM10

102 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

11.054 kDa

MSFLFGGNNRSVEGSVDPAKIEMAVAELDMITDVFNRLVNSCHTKCISSTPLNHRYAEGDLLKGESVCIDRCTAKFFEVNKKVGERMSAMGSAAQATGSFGR

TIM10

Mitochondrial import inner membrane translocase subunit TIM10

102 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

11.054 kDa

MSFLFGGNNRSVEGSVDPAKIEMAVAELDMITDVFNRLVNSCHTKCISSTPLNHRYAEGDLLKGESVCIDRCTAKFFEVNKKVGERMSAMGSAAQATGSFGR

TIM10

Mitochondrial import inner membrane translocase subunit TIM10

95 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.504 kDa

MSFLGMGRPQPTSEQKIAAVESEMRMMADTYNRLQQSCQKKCVPNDYREGELNKGESVCLDRCTAKFLDTSMKVSEIMQQQGQALGGQQGGGGMF

tim10

Mitochondrial import inner membrane translocase subunit tim10

93 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.235 kDa

MSFLFGGPPKMSSAEKIAAAETEVEMVSDMFNRLTESCQKKCIPNDYREGDLNKGESVCLDRCVSKFFEVNIKVSEKMQGEAAQKQGAPGFGM

tim10

Mitochondrial import inner membrane translocase subunit tim10

93 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.103 kDa

MSFLFGGAPKMSSEQKIAAAETEVEMITDMFNRLSESCSKKCIPNDYREGDLNKGESVCLDRCVGKFFEVNIKVSEKMQGVAGQQQGGAGLSL

TIM10

Mitochondrial import inner membrane translocase subunit TIM10

93 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Compared to TIM9, it may function as a substrate sensor.

Belongs to the small Tim family.

10.305 kDa

MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF

Tim10

Mitochondrial import inner membrane translocase subunit Tim10

92 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.578 kDa

MALPQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESELGKGEMVCIDRCVAKYLDIHEKIGKKLTAMSMQDEELMKKMSS

TIM10

Mitochondrial import inner membrane translocase subunit TIM10

91 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.108 kDa

MFGLGGAAPQISSQQKLQAAEAELDMVTGMFNQLVEQCHSKCINKTYNDSEVSKQEALCLDRCVAKYFETNVQVGEHMQKMGQSGQFMGRQ

tim10

Mitochondrial import inner membrane translocase subunit tim10

90 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

Belongs to the small Tim family.

9.923 kDa

MFGLGRPQPTSAEKIAAVENELKVVAEMHSRMVKICTLKCIDKSYREGDLSKGESVCLDRCAAKFFETHQKISDQLQKETQARGGGGFGM

TIM10

Mitochondrial import inner membrane translocase subunit Tim10

90 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

9.935 kDa

MFGLGGAPQISSEQKLQAAEAELDMVTGMFNQLVDQCHSKCINKSYGDSDITKQEALCLDRCVAKYFDTNVQVGEHMQKLGQSGQFMGRK

TIM10

Mitochondrial import inner membrane translocase subunit TIM10

89 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

9.966 kDa

MFGLGGQPQLSSQQKIAAAEAELDLVTDMFNKLVSNCHRKCIDMNYNEGDLNKNESNCLDRCVAKYFETNVKVGENMQQLGQNFSPGKF

TIM10

Mitochondrial import inner membrane translocase subunit TIM10

89 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

9.935 kDa

MFGLGGQPQLSSQQKLSAAEAELDLVTDMFNKLVDNCHKKCIEQIYNDGQLNKNESTCIDRCVAKYFETNVKVGENMQQLGQAFSPGKF

tim10

Mitochondrial import inner membrane translocase subunit tim10

89 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.195 kDa

MSMFGIGKNNQTINPQNIAMAEQEVEMMSDIFNRLVMTCHKKCISPKYYEADLTKGESVCIDRCVSKYFEANQSLSQHMQKRGQENPTP

TIM10

Mitochondrial import inner membrane translocase subunit TIM10

83 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

9.339 kDa

MASPIPVGVTKEQAFSMAQTEMEYRVELFNKLAQTCFNKCVDKRYKEAELNMGENSCIDRCVSKYWQVNGMVGQLLSAGKPPV