About Products Protein Database Contact

Protein expression services for tim10 | Mitochondrial import inner membrane translocase subunit tim10

Description
Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.
Family
Belongs to the small Tim family.
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Length
90 amino acids
Sequence
MFGLGRPQPTSAEKIAAVENELKVVAEMHSRMVKICTLKCIDKSYREGDLSKGESVCLDRCAAKFFETHQKISDQLQKETQARGGGGFGM
Mass
9.9 kDa
Simulated SDS-PAGE
Western blot of tim10 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make tim10 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here