STS1

Stachyose synthase

853 amino acids

Catalyzes stachyose synthesis by transfer of a galactosyl moiety from galactinol to raffinose. Also catalyzes verbascose synthesis by galactosyl transfer from galactinol to stachyose or from one stachyose molecule to another. Oligosaccharides of the raffinose family play a protective role in maturation drying of seeds. They may act as cryoprotectants in frost-hardy plants.

Belongs to the glycosyl hydrolases 36 family.

95.89 kDa

MAPPLNSTTSNLIKTESIFDLSERKFKVKGFPLFHDVPENVSFRSFSSICKPSESNAPPSLLQKVLAYSHKGGFFGFSHETPSDRLMNSIGSFNGKDFLSIFRFKTWWSTQWIGKSGSDLQMETQWILIEVPETKSYVVIIPIIEKCFRSALFPGFNDHVKIIAESGSTKVKESTFNSIAYVHFSENPYDLMKEAYSAIRVHLNSFRLLEEKTIPNLVDKFGWCTWDAFYLTVNPIGIFHGLDDFSKGGVEPRFVIIDDGWQSISFDGYDPNEDAKNLVLGGEQMSGRLHRFDECYKFRKYESGLLLGPNSPPYDPNNFTDLILKGIEHEKLRKKREEAISSKSSDLAEIESKIKKVVKEIDDLFGGEQFSSGEKSEMKSEYGLKAFTKDLRTKFKGLDDVYVWHALCGAWGGVRPETTHLDTKIVPCKLSPGLDGTMEDLAVVEISKASLGLVHPSQANELYDSMHSYLAESGITGVKVDVIHSLEYVCDEYGGRVDLAKVYYEGLTKSIVKNFNGNGMIASMQHCNDFFFLGTKQISMGRVGDDFWFQDPNGDPMGSFWLQGVHMIHCSYNSLWMGQMIQPDWDMFQSDHVCAKFHAGSRAICGGPIYVSDNVGSHDFDLIKKLVFPDGTIPKCIYFPLPTRDCLFKNPLFDHTTVLKIWNFNKYGGVIGAFNCQGAGWDPIMQKFRGFPECYKPIPGTVHVTEVEWDQKEETSHLGKAEEYVVYLNQAEELSLMTLKSEPIQFTIQPSTFELYSFVPVTKLCGGIKFAPIGLTNMFNSGGTVIDLEYVGNGAKIKVKGGGSFLAYSSESPKKFQLNGCEVDFEWLGDGKLCVNVPWIEEACGVSDMEIFF

STS1

Sesquiterpene synthase 1

561 amino acids

Involved in the biosynthesis of delta-cadinene.

Belongs to the terpene synthase family. Tpsa subfamily.

64.339 kDa

MAVYVNSTTGPPPSVGRNSAGFHPSIWGDKFITSSNSAVQKTDVDRKEEEKLQLLKQEVKKMLTAGDTSQQDLICLIDDIQRLGLSYHFEAEIDTLLQHVKHSYVEHYGKKNHDNLHDVALSFRLLRQEGHNISSDVFSKFQDSDGKFKEELVEDVRGMLSLFEAAHLRVHGENILEDALEFTTTHLNSYLNSNPSSSLADLVRRALKYPLRKSFNRMVARHYISVYHKFDWHKQVLLDMAKCDFNLVQKVHQNELGYITRWWKDLDFTNKLPFARDRVVECYFWITGVYFEPRYAAPRKFLTEVMSLTSIIDDIYDVYGTPDELVQLADAIDKWDISILDQLPEYVRHAYKPLLDTFAEAEEEMANEGLPTYGVDYAKEAFKRLAVAYLQETKWLQAQYIPTFEEYLSVALVSAGGNMLSVSSFVRMGNIATREAFEWLSKDPLIANGLSVIIRLSDDIVGHEFESQRPHIPSAVECYMKSHDVTKETAYAELQKPIIKAWKDMNEGCLHPEAPPKPLLERVLNLARVLNFLYDGHDGYTHSSTRTKDIITTAFINPIPL

sts1

Delta(24(24(1)))-sterol reductase

453 amino acids

Belongs to the ERG4/ERG24 family.

52.546 kDa

MKSTVKKSAPREFGGAKGALAIMTGFPCLMYYLWACSKFNDSQFIKPESFTIAGFQNFFRTLGHYIYVGAYPTRYAFLVFWSFCIVQAVMYLTLPGVRTQGLPLKHRNNERLPYLCNAIWSFYTTIVILAVLHVTHVFPITTFIDMFGPLMSVAIITAFVCTFVLYTGTLLFGDRLFDKPHRLSGNPIYDAFMGACLNPRLGKLLDFKMFFEVRIPWFILFFISVGAAVRQYETYGTVSPQVLFVCLGHYLYANACSKGEQLIVPTWDMAYEKFGFMLIFWNMAGVPFTYSHCTLYLFSHDPSVYNWSTQYTTGIYVLLLCCYYIFDTCNGQKNHFRNQIYGTEVHRKTFPQLPWLIIKNPTFIRCANGGTLLTSGWYRYARKIHYTADFFQSLSWALITGFQSPLPYFYPCFFFVVLVHRVSRDIKKCKAKYGADFDEYCRICPYLFIPYIF

STS1

Tethering factor for nuclear proteasome STS1

437 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

49.28 kDa

MMSASFHWKHRSNEQGKNPLDKSAMPSSTLHYMSTNNSTNNGTGTSTNTSGSSSHYTIAPRSFSEMVPSQQQQQQNKKRKRYSDDDSETHNETHSENNNDTSQEQFKPHNHRDQTASGLLHLQQQQLQQQHSLLLLQQLHYFHGSSKTKRTKIPKIIGQPLPTSRLIESLDKTHLEKLLHSLIDIHPELNKTIQKITPKPSLENLLLILQDKHAQLIDHLPYKCSETSDYSYLRIKPYLQEFLSCLEDYVLYYLPSNNYSETKHKLIQSLKFIDEATSTIHKLPNFTNSEYQYMRNLTYEQLINCWLILVNQETNCDTGNGLDYTEFHKIVEELDLLESLKQHGVQSGQEGFSKVIEAVQNKLGQNQILLSRQFGIDYGNDMTVSSSNGNRSGTGAGFGGGGGGASRSGSGSGTSSNALSDMITVDYSLYSLSNRSV

STS1

Tethering factor for nuclear proteasome STS1

367 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

40.779 kDa

MMSAGFQWGGVPNKGLTQEHSTDKSTTDSHIPRYGSSSSSSSSSSSSSSSSYALTSSSASSSTTPHQTISHSPLATTLKKRKREDTSDVNLPINNGISSKRFVHPTASSKYKRSKTPKIIGQPLPLHRLIESLDKSNLQKLVQDLIIIHPELQSTMSKIAPKPTIQDSLDLLHEKFNMIISHLPYKCDVESDYSYLRIKPHLQEFLSCVSDFILNYLPPLESNMIHSLQFLEEVTKMIIHNLPNFTNQEFQYTKSTALDQLANCWLIVLSQSDNNGEKEDVAADIGVVVKVIQELELLEKLQKHNEVSLNKFQKVIDYCNDKLEQHELIINNGNAASVNNNGAVPASLSDLISVDYSKYSLTNTSSI

STS1

Tethering factor for nuclear proteasome STS1

350 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

39.814 kDa

MMSTGFSWGTQALSESTEVNSGLGDLPTSIPRYTPNLKPVNNNHHSNGKKRRYSEDQESKVVKPTGNRKHYTTPSTYYKSKKSRTPKIMGQKLPINRLVEALDHTSLQRLLESLIHEHPEISNTIDKISPKPTLTDSIELIKQKFNSIMHHLPYKCDTESDYSYLRIKTHLNEFLNCLSDFILNFLPPIETNVFNSLKFLDEVTDLIHTLPNFSNSEFQYTKSMAYEQISNTWLIVLNHKMRPDDGTNNNNTSNTNEALSSSSSPSPVAQCNMENSAQLIKIIDELNLQQKLAKHDNMSIGKFKLVVEFVNSEIENYENFNHTVTNNGGILNDLITVDYSNFSIAARTSH

STS1

Tethering factor for nuclear proteasome STS1

341 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

37.938 kDa

MNSLIATPPVPPHFYETSCRSPSYSMSSTNTSVNRKRKAEDDCPPSGDTRMSASPSGSPALHPRPLAPRHLKRPRPNVSGRPLSLPRLMETLDTDALRSVLRSLCDRHPEIASEVMHTAPRPSVSAALEVLSNYQSTLQSSFPLGGNPSSDYAYNRVRQHLTNLLEALNDFTPHFLPPNESQPSTSLSYLDGATDIIHRLPRWTTPQHNIEEYAATEAGTKNWQSTNETAGGKLQDALKRAQPEPWVDRWQTWATRATALRETSRRYANSSCRAHTVLAYRSKSGHGNSIQYQSSKPHFLFSTFNPSIHPSITALLSTPHYTVQVDGFRAIFNETITIPIC

STS1

Tethering factor for nuclear proteasome STS1

333 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

37.765 kDa

MMSTNFHWPTTNKNDNREVSIETPTSTDPHVPRDSLASMPHATASTTIKKRKRDDELDGDKSTTTTTTTTTVSSSSTRKYLQSSLGSSKFKKAKTPKISGQPLPLPRLIESLDRSNLQKLVQGLIAVHPELQSTLIKISPRPSIQDSIQLLQDKFDMIISHLPYKCDVESDYSYLRIKPHLQEFLSSVSDFILNYLPPLETNMTRSLQFLHEATKLVYNLPNFTNQEFQYTKSTALEQIANCWLIVLSQDEEKDGNTDVVKVIHELELLEKLHEHNEISFNKFEKVVDYCKDKLEQHELIMNNNEAGSGVPSSISDLITVDYSKYSIANTTSI

STS1

Tethering factor for nuclear proteasome STS1

333 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

37.911 kDa

MSQSVGFEWGFRPSVSSGENLNMGQEQTSSTESNDISNDHERAHGHIQSSQHRLTHGTSSRRISKPRIKRRYTEEDVSMNGPVSQVVQRVSKKKPVYRNYIQGQPLPFPRSVELMDKQLLQSVLLSLVREHPEIQHSLFSKVQSISFNKEQYVKVLKEKLTQVYEDIPYSKYNQSSDGLLNDYAFGRMKASIMEFLNCVIDFLLSSIPPQSDSVLQSLKFLNCSTDFLNQLPDFETASNNYYKNMCFEQISEIWCSCIQFASTDLSFMSVVSNLEDWESVLHTLNGRSNNRLQKPLELIGTIKNSAAMMSQDRNGHPLSQTQPSTVGFLNISS

STS1

Tethering factor for nuclear proteasome STS1

327 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

37.321 kDa

MMSTNFQWPGTNKNDNTEVSVETPSSTDPHVPRYPFTAMSHATASTTMKKRKRDDFDGDKSTTITMNTTTTRKYIQSSLGSSKFKKAKTPKISGQPLPLPRLIESLDKSNLQKLVQDLITVHPELQSTLIKISPRPSIQDSIQLLQDKFDMIISHLPYKCDVESDYSYLRIKPHLQEFLSSVSDFILNYLPPLETNMTHSLQFLHETTKLVYNLPNFTNQEFQYTKSSALEQIANCWLIVLSQDEEKEGNTDVVKVIQELELLEKLHEHNEISFNKFEKVVDYCKDKLEQHELIMNNNEAGSGVTSSISDLITVDYSKYSIANTTSI

STS1

Tethering factor for nuclear proteasome STS1

327 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

37.321 kDa

MMSTNFQWPGTNKNDNTEVSVETPSSTDPHVPRYPFTAMSHATASTTMKKRKRDDFDGDKSTTITMNTTTTRKYIQSSLGSSKFKKAKTPKISGQPLPLPRLIESLDKSNLQKLVQDLITVHPELQSTLIKISPRPSIQDSIQLLQDKFDMIISHLPYKCDVESDYSYLRIKPHLQEFLSSVSDFILNYLPPLETNMTHSLQFLHETTKLVYNLPNFTNQEFQYTKSSALEQIANCWLIVLSQDEEKEGNTDVVKVIQELELLEKLHEHNEISFNKFEKVVDYCKDKLEQHELIMNNNEAGSGVTSSISDLITVDYSKYSIANTTSI

STS1

Tethering factor for nuclear proteasome STS1

326 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

37.64 kDa

MENNTAVLGAGFSWGFKSDNVMKCQEQEEQQARENEKSLNSMVANLVQAQGMDPKGRKRRLDEPTNPQPQMMVPPRKYNVSKRRPHHSTISGQPLPLHRGLELMSKDQLQYILIEVMKNYPISQQLVQNKLVDFNFSIEKCEILLKEKLQQLHESIPYSRSHDYQRLSDYAFVRMKPHILEFLNCLVDCVLDRIPPRVDNLHESLKILDMTTDMVTKLPRFQLASNNYYYDKCLEQLACLWCTVIEHIARDVIMTVNDAPLLRNWIQKLELYNELCHGILTKPLNQFKSLAVVDAGVTDSNSTKGTNATRNRWSGSTDNYTVGDNQ

STS1

Tethering factor for nuclear proteasome STS1

320 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

35.756 kDa

MSQSVGFEWGFKAGGEGRPRAQGDGAGCAGATAAANSQQGCGHLVHMSYKVGKPKMKRRLTNEEHGGARRAKRQPAQFNVIQGQPLPVHRKIEMMDKAALQLTLLQLVAMHPEVQDSLSVLQPTSPDPAKYTELLEQKMQAVYDHIPYSKSSDMLNDYAFVRMKAAILEFLNCLIDCLLDAIPPRTTNLLQSFKFLAYGTRLLAQMPHFETESNNYYKNICYEQVSEIWNTLIRHASSDINFLSTKPSLLHYLHELKQFNEQTKGKFDIPLRLFYTIMDDYHTQTVPAAAAVASTSATVAEELNGNSKSMETLGIWNNVA

STS1

Tethering factor for nuclear proteasome STS1

319 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

36.485 kDa

MMGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN

STS1

Tethering factor for nuclear proteasome STS1

319 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

36.499 kDa

MMGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHIARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN

STS1

Tethering factor for nuclear proteasome STS1

319 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

36.548 kDa

MMGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLLRGMELMNKNQYRQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN

STS1

Tethering factor for nuclear proteasome STS1

319 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

36.485 kDa

MMGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN

STS1

Tethering factor for nuclear proteasome STS1

319 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins. Required for efficient chromosome segregation. Restores protein transport and ribosomal RNA stability.

Belongs to the cut8/STS1 family.

36.485 kDa

MMGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN

STS1

Tethering factor for nuclear proteasome STS1

318 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

36.353 kDa

MGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN

STS1

Tethering factor for nuclear proteasome STS1

318 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

36.366 kDa

MGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHXARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN

STS1

Tethering factor for nuclear proteasome STS1

318 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

36.353 kDa

MGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN

STS1

Tethering factor for nuclear proteasome STS1

318 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

36.353 kDa

MGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYGGVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFSIQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPRLENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLADNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTMTANENNNNSGSAATDSPFN

STS1

Tethering factor for nuclear proteasome STS1

317 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

36.48 kDa

MATGYNWVPEKYLESKSKHKYGDILQKSDSFKHDLGNSFRKRRHDDDYGKVGKPQSQPTRPIQRSKRIKTPKIIGQALPVSRVVEVLDHRSLQQLLTKLLTIHPEVATTINKLSPRPELKDCLETLRERFDEIINHLPYKCDVESDYSYLRVKPHLNEFLSCLSDLTLSFLPPIEVNTLQSLTFLDYVTSLIHQLPNFANTEFQYTKVQAYDQLANTWIIAFNHSLNDEDCQEVASTKDAKVESLSKIVKMIEDNDLINKLEKHNDLSQGKFRMVIELVKATVDNYESLSESLRAKSLLGDMFTVDYSNFVAAQSLN

sts1

Tethering factor for nuclear proteasome sts1

315 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.592 kDa

MNSLVATPPVPPHIYEYSRLSPSRPMSTPSHTPTTNRKRKAEDEHNDFDSRMSASPTNSPAFTPRTLPSSSRQIKRARPNMGGRPLSLPRLLETLDTDALRGVLRSICDRHPNLADEVVQTAPRPSVASALQVLRNYQSALQSSFPLGGNPESDYAYNRVRQPLGNLLEALSDFTPHFLPPNETQPSISLSYLDDVTEIIHQLPRWSSPQNNIERDSAYDEICKAWILVIREAAKRGGGIQLQYGGWDQKLAKHNQNSGGRLQAAVNDLASSLGWMHGPESQGFGSPGGNDLGSIREQLLSGTYGLGTPVKVGPW

sts1

Tethering factor for nuclear proteasome sts1

315 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.608 kDa

MNSLVATPPVPPHFYEHSRFSPSRSMSTPAQQSSNRKRKAEDDGNDVDIRMSASPTNSPAFTPRPLPNRQMKRSRPNVSGRPLSLPRLLETLDTDALRSVLQAVCQRHPELGDEVVHTAPRPSVSSTLQVLRNYQSTLQTSIPLGSGEYLSDYAYNRVKQHLFNLLDALSDFTPHFLPPNESQTSVSLTYLDGATDIIHSLPKWQTPRHNIGRDSAYEEICKAWVLVIREAAKRGGGIQLQYGGWDQKLAKHNETSGGKLQDAINELQNSLGWMGSSALPGVGAAGTQGGDQTSIREQLLSGTYGMGMPLKVGPW

STS1

Tethering factor for nuclear proteasome STS1

314 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.399 kDa

MNSLVATPPVPPHFYETSCRSASYSMSSTNASVNRKRKAEDDCLPSDDTRMSASPSGSPALHPRPLAPRHLKRSRPNVSGRPLSLPRLMETLDTDALRSVLRSLCDRHPEIASEVMHTAPRPSVSAALEVLNNYQSTLQSSFPLGGNPSSDYAYNRVRQHLTNLLEALNDFTPHFLPPNESQPSTSLNYLDGATDIIHRLPRWTTPQHNLEKYAAYEEMSKAWCLVIREAAKRGGGIQLQYGGWDQKLAKHNETAGGKLQDAVNELNQSLGWIGGNVGNPSYPGGSNSQGDMSIRQQLMSGTYGAGLPLKVGPW

sts1

Tethering factor for nuclear proteasome sts1

314 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.394 kDa

MNSLVATPPVPPHFYEYSRLASARQMSTPTVTPNSRKRKAEDDTADHDGRMSASPTSSPAFTPRTLPSARNVKRTRPNISGRPLSLPRLLETLDTDALRGMLRSMCERHPSLADEIVHTAPRPSVSSALQVLRQYQSNLQSSFPLGGNPASDYAYNRVRQPLGQLLDALSDFTPHFLPPNETQPSVSLSYLDDATEIIHALPRWSTPQNNIERDSAYDEICKAWILVIREAAKRGGGFQLQYGGWEQKLAKHNQNSGGKLQAAVHELASCLGWMHGPDTQAYGGSGGNNDLGSIREQLLSGTYGLGTPVKVGPW

STS1

Tethering factor for nuclear proteasome STS1

314 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.49 kDa

MNSLVATPPIPPHFYEHNRFNTTSRFVSPMNPAGSRKRKAEDDNGSSDHDTRMSASPTSSPALPTKPLAARQIKRPRPNLSGRPLSLGRLFETLDSDALRSVLRSLCDRHPELGQEVVDTAPRPNITSALQVLSNYQSTLQSSFPLGGNPSSDYAYNRVRPHVMNLLDALNDFTPHFLPPNETHPSTSLNYLDGVTEIIHQLPRWDTPHYNLEKEAAYEEIAKAWALVIREASKRGGGIQLQYGEWDQKLAKHNQTSGGKLQDAVHELSASLGWMAGNPSHPGPGCPQADTASIRQQLLSGTYGAGLPLKVGPW

STS1

Tethering factor for nuclear proteasome STS1

314 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.49 kDa

MNSLVATPPIPPHFYEHNRFNTTSRFVSPMNPAGSRKRKAEDDNGSSDHDTRMSASPTSSPALPTKPLAARQIKRPRPNLSGRPLSLGRLFETLDSDALRSVLRSLCDRHPELGQEVVDTAPRPNITSALQVLSNYQSTLQSSFPLGGNPSSDYAYNRVRPHVMNLLDALNDFTPHFLPPNETHPSTSLNYLDGVTEIIHQLPRWDTPHYNLEKEAAYEEIAKAWALVIREASKRGGGIQLQYGEWDQKLAKHNQTSGGKLQDAVHELSASLGWMAGNPSHPGPGCPQADTASIRQQLLSGTYGAGLPLKVGPW

sts1

Tethering factor for nuclear proteasome sts1

313 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.309 kDa

MNSLVATPPVPPHFYEHSRFSSPHPMSNPIHTPSSRKRKADDDGNDHDGRMSASPTNSPAFTPRSLPTPRSFKRSRPNVFGRPLSLPRLLETLDTDALRGILRSMCERHPALADEVIHTSPRPSVTSALQVLRNYQTALQNSFPLGGNPESDYAYNRVRQPLGNLLDALSDFTPHFLPPNESQASVSLSYLDGATEIIHALPRWNSPQNNIERDSAYDEICKAWVLVIREAAKRGGGIQLQYGGWDQKLSKHNHNSGGRLQAAVNELGNSLGWMHGPDSQGYSSPAAGDLGSIRDQLLSGTYGLGTPVKVGPW

sts1

Tethering factor for nuclear proteasome sts1

313 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.278 kDa

MNSLVATPPVPPHFYEYSRLSSPHPMSTPTHTPINRKRKADDDGNDHDGRMSASPTNSPAFTPRSLPAPRSFKRSRPNVSGRPLSLPRLLETLDTDALRGILRSMCERHPALADEVIHTSPRPSVSSALQVLRNYQSTLQNSFPLGGNPESDYAYNRVRQPLGNLLDALSDFTPHFLPPHETQASVSLSYLDGATDIIHALPRWHSPQNNIERDSAYDEICKAWILVIREAAKRGGGIQLQYGGWDQKLAKHNQNAGGRLQAAVNELGNSLGWMHGPDSQGYGSSTGGDLVSVREQLLSGTYGLGTPVKVGPW

STS1

Tethering factor for nuclear proteasome STS1

313 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.174 kDa

MNVLLTPQPTPFPHQYETSRLSPQRSLSPYTNMTSRKRKADDNEGDEMSVSPLSSPAIPSRHLSRPSKKIRAAEASGRPLPLPRLLETLDTTQLRTVLQKICERHPDIGQEVVNGAPRPSVGSALGILRDYQQRLRGAIPYGQTSSDYTYYRVKQPLMALVDAISDFTPQFLPPIETQVTASLQYLDGATKVVHELPDWDSQAYRQHKDNAYDEISRAWALVITEASKRGGGFVLHTGGWDQMLAKHNQQSGGRLGSAMQAMASNGWIGNNSPNNQNASASSSSGSGAGGDPNSILNQLVNGTYGNPVRVGPW

sts1

Tethering factor for nuclear proteasome sts1

313 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.266 kDa

MNSLVATPPVPPHFYEYSRLSSPHPMSTPTHTPTNRKRKADDDGNDHDGRMSASPTNSPAFTPRSLPAPRSFKRSRPNVSGRPLSLPRLLETLDTDALRGILRSMCERHPALADEVIHTSPRPSVSSALQVLRNYQSTLQNSFPLGGNPESDYAYNRVRQPLGNLLDALSDFTPHFLPPHETQASVSLSYLDGATDIIHALPRWHSPQNNIERDSAYDEICKAWILVIREAAKRGGGIQLQYGGWDQKLAKHNQNAGGRLQAAVNELGNSLGWMHGPDSQGYGSSTGGDLVSVREQLLSGTYGLGTPVKVGPW

STS1

Tethering factor for nuclear proteasome STS1

312 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.358 kDa

MNSLLATPPVPPHFYEHCRLSPSRSMSSTNPSGNRKRKAEDDYLPSDHDTRMSASPSNSPAFPPRPLPASRQIKRSRPNISGRPLSLSRLLETLDTDALRSVLRSMCDRHPELATEVVHTAPRPSVSSALQVLNNYQSALHSSIPLGGNSSSDYAYNRVRQHIVNLLDALSDFTPHFLPPNESQTSTALSYLDGATEILHRLPRWDTPQNNLEKDAAYEEMAKAWILVIREAGKRGGGIQLQYGGWDEKLSKHNQTAGGKLQDAVDVLSSNLGWMGTNQDLSNNQGVDASSIRQQLLSGTYGSGMPLKVGRW

STS1

Tethering factor for nuclear proteasome STS1

312 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.371 kDa

MNSLLATPPVPPHFYEHCRLSPSRSMSSTNPSGNRKRKAEDDYLPSDHDTRMSASPSNSPAFPPRPLPASRQIKRPRPNISGRPLSLSRLLETLDTDALRSVLRSMCDRHPELATEVVHTAPRPSVSSALQVLNNYQSALHSSIPLGGNSSSDYAYNRVRQHIVNLLDALSDFTPHFLPPNESQTSTALSYLDGATEILHRLPRWDTPQNNLEKDAAYEEMAKAWILVIREAGKRGGGIQLQYGGWDEKLSKHNQTAGGKLQDAVDVLSSNLGWMGTSQDLSNNQGVDTSSIRQQLLSGTYGSGMPLKVGRW

sts1

Tethering factor for nuclear proteasome sts1

312 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.193 kDa

MNSLVATPPVPPHFYEYSRLSSSRPMSTPTYTPNSRKRKADDDGNDHDGRMSASPTSSPAFTPRSLPSRNMKRARPNVSGRPLSLPRLLETLDTDALRGVLRSMCERHPGLVDEVVHTAPRPSVSSALQVLRNYQSTLQSSFPLGGNPASDYAYNRVRQPLSNLLDALSDFTPHFLPPNEIQPSLSLNYLDGATEIIHALPRWHTPQNNIERDSAYDEICKAWILVIREAAKRGGGIQLQYGGWDQKLAKHNQNSGGKLQAAVNELGASLGWMHGPETQSHASPGGNDFGSIREQLLSGTYGLGTPVKVGPW

sts1

Tethering factor for nuclear proteasome sts1

312 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.181 kDa

MNSLVATPVPPHFYEYSRLSSPHPMSTPTHTPINRKRKADDDGNDHDGRMSASPTNSPAFTPRSLPAPRSFKRSRPNVSGRPLSLPRLLETLDTDALRGILRSMCERHPALADEVIHTSPRPSVSSALQVLRNYQSTLQNSFPLGGNPESDYAYNRVRQPLGNLLDALSDFTPHFLPPHETQASVSLSYLDGATDIIHALPRWHSPQNNIERDSAYDEICKAWILVIREAAKRGGGIQLQYGGWDQKLAKHNQNAGGRLQAAVNELGNSLGWMHGPDSQGYGSSTGGDLVSVREQLLSGTYGLGTPVKVGPW

sts1

Tethering factor for nuclear proteasome sts1

312 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.193 kDa

MNSLVATPPVPPHFYEYSRLSSSRPMSTPTYTPNSRKRKADDDGNDHDGRMSASPTSSPAFTPRSLPSRNMKRARPNVSGRPLSLPRLLETLDTDALRGVLRSMCERHPGLVDEVVHTAPRPSVSSALQVLRNYQSTLQSSFPLGGNPASDYAYNRVRQPLSNLLDALSDFTPHFLPPNEIQPSLSLNYLDGATEIIHALPRWHTPQNNIERDSAYDEICKAWILVIREAAKRGGGIQLQYGGWDQKLAKHNQNSGGKLQAAVNELGASLGWMHGPETQSHASPGGNDFGSIREQLLSGTYGLGTPVKVGPW

STS1

Tethering factor for nuclear proteasome STS1

312 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.358 kDa

MNSLLATPPVPPHFYEHCRLSPSRSMSSTNPSGNRKRKAEDDYLPSDHDTRMSASPSNSPAFPPRPLPASRQIKRSRPNISGRPLSLSRLLETLDTDALRSVLRSMCDRHPELATEVVHTAPRPSVSSALQVLNNYQSALHSSIPLGGNSSSDYAYNRVRQHIVNLLDALSDFTPHFLPPNESQTSTALSYLDGATEILHRLPRWDTPQNNLEKDAAYEEMAKAWILVIREAGKRGGGIQLQYGGWDEKLSKHNQTAGGKLQDAVDVLSSNLGWMGTNQDLSNNQGVDASSIRQQLLSGTYGSGMPLKVGRW

sts1

Tethering factor for nuclear proteasome sts1

312 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.286 kDa

MNSLVATPPVPPHFYEHSRFSPSRSMSTPVQQNSNRKRKAEDDGNDVDVRMSASPTNSPAFTPRPLPNRQMKRSRPNVSGRPLSLPRLLETLDTEALRSVLQAVCQRHPELGDEVVHTAPRPSVASTLQVLRNYQSTLQTSIPLGSGEYLSDYAYNRVKQHLFSLLEALSDFTPHFLPPNESQTSVSLTYLDGATDIIHGLPKWQTPRHNIGRDSAYEEIGKAWVLVIREAAKRGGGIQLQYGGWDQKLAKHNETSGGKLQDAVNELRNSLGWMGSSALPGAGASGGDQISIREQLLSGTYGMGMPLKVGPW

STS1

Tethering factor for nuclear proteasome STS1

311 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.147 kDa

MNSLLATPPVPPHFYEHCRLSPSRSMSSTNPSGNRKRKAEDDYLPSDHDTRMSASPSNSPAFSPRTLPAPRQIKRSRPNISGRPLALSRLLETLDTDALRSILRSMCDRHPELASEVVQTAPRPSVSSALQVLNNYQSALQSSIPLGGNSSSDYAYNRVRQHIVNLLDALSDFTPHFLPPNESQVSTALNYLDGATEIIHRLPRWDTPQHNLEKDAAYEEMAKAWILVIREAGKRGGGIQLQYGGWDQKLSKHNQTAGGKLQDAVNTLSSNLGWMGNQDLSNSQGGDASSIRQQLLSGTYGSGMPLKVGPW

STS1

Tethering factor for nuclear proteasome STS1

311 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.147 kDa

MNSLLATPPVPPHFYEHCRLSPSRSMSSTNPSGNRKRKAEDDYLPSDHDTRMSASPSNSPAFSPRTLPAPRQIKRSRPNISGRPLALSRLLETLDTDALRSILRSMCDRHPELASEVVQTAPRPSVSSALQVLNNYQSALQSSIPLGGNSSSDYAYNRVRQHIVNLLDALSDFTPHFLPPNESQVSTALNYLDGATEIIHRLPRWDTPQHNLEKDAAYEEMAKAWILVIREAGKRGGGIQLQYGGWDQKLSKHNQTAGGKLQDAVNTLSSNLGWMGNQDLSNSQGGDASSIRQQLLSGTYGSGMPLKVGPW

STS1

Tethering factor for nuclear proteasome STS1

311 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.209 kDa

MNSLLATPPVPPHFYEHVRLSPSWSMSSANSSGNRKRKAEDDNPSDHDTRMSASPSNSPALAPRPLPTARQIKRPRPNISGRPLPLSRLLETLDTDALRSVLRSMCNRHPELETEVVHTAPRPSVSSALQVLSNYESTLQSSFPLGGNSSSDYAYNRVRQHITNLLDALNDFTPHFLPPNESQVSTALNYLDGATEILHRLPRWDTPQHNLEKDVAYEEIAKAWIVVIREAGKRGGGIQLQYGGWDLKLSKHNQTAGGKLQDAINVLSSSLCWMGGHQDSSASQGGDPTSIRHQLLSGTYGSSSPLKVSKW

STS1

Tethering factor for nuclear proteasome STS1

311 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.092 kDa

MNSLLATPPVPPHFYEHVRLSPSRSMSSANSSGNRKRKAEDDNPSDHDTRMSASPSNSPALAPRPLPTARQIKRPRPNISGRPLPLSRLLETLDTDALRSVLRSMCNRHPELETEVVHTAPRPSVSSALQVLSNYESTLQSSFPLGGNSSSDYAYNRVRQHITNLLDALNDFTPHFLPPNESQVSTALSYLDGATEILHRLPRWDTPQHNLEKDVAYEEIAKAWIVVIREAGKRGGGIQLQYGGWDLKLSKHNQTAGGKLQDAINVLSSSLGWMGGHQDSSASQGGDPSSIRHQLLSGTYGSSSPLKVSKW

STS1

Tethering factor for nuclear proteasome STS1

311 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.092 kDa

MNSLLATPPVPPHFYEHVRLSPSRSMSSANSSGNRKRKAEDDNPSDHDTRMSASPSNSPALAPRPLPTARQIKRPRPNISGRPLPLSRLLETLDTDALRSVLRSMCNRHPELETEVVHTAPRPSVSSALQVLSNYESTLQSSFPLGGNSSSDYAYNRVRQHITNLLDALNDFTPHFLPPNESQVSTALSYLDGATEILHRLPRWDTPQHNLEKDVAYEEIAKAWIVVIREAGKRGGGIQLQYGGWDLKLSKHNQTAGGKLQDAINVLSSSLGWMGGHQDSSASQGGDPSSIRHQLLSGTYGSSSPLKVSKW

sts1

Tethering factor for nuclear proteasome sts1

311 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.341 kDa

MNSLVATPPVPPHFYENSRFSPSRMMSTPSSSYSSRKRKADDDNDHDGRMSASPTNSPAFTPRQLPHSYRNIKRSRPNVSGRPLSLPRLLETLDTDALRTVVRTMCERHPQLADEVVHTSPRPNVSSTLQVLRNYQAALQSSFPLGGNTESDYAYNRVRQPLTNLLDALSDFTPNFLPPNESQASTSLSYLDGATDIIHALPRWSTPQNNIERDSAYDEMCKAWILVIREAAKRGGGIQLQYGGWDQKLAKHNQTSGGKLQGAVNELGFSLGWMNGPDTPSHGANSEMGSIRDQLFSGTYGLGTPVKVGPW

sts1

Tethering factor for nuclear proteasome sts1

310 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

34.013 kDa

MNVQYQAFTPPHLLNNTRRSPTRNISSLSSTMSGRKRKAEDDGSAGDDDRMSASPSASPAVLPRPAPRGMKRMRTNISGRPLPLPRLLETLSPDDMRNLLQSICQRHPDISNEIVTTAPRPSIQSTLEVLAKYEASFQAAFPFGGRASSDYAYNRVRQQLDELLDSLKDFTPHFLPPNEQQPATSLTFLDGATNIIHRLPNWDTFQHNRHKQEAYEEMAKAWAMVIQEAAKKAGGIQLQYGGWDEKIAKHNEISGGKMQEAVNELRGGLGWMGAETSNSAAGAPADAMSIRQQLLSGNYGAGSPASIGAW

sts1

Tethering factor for nuclear proteasome sts1

310 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.978 kDa

MNVQYQAFTPPHLLNNTRRSPTRNISSLSSAMSGRKRKAEDDGSAGDDDRMSASPSASPAVLPRPAPRGMKRMRTNISGRPLPLPRLLETLSPDEMRNLLQSICQRHPDISNEIVTTAPRPSIQSTLEVLAKYEASFQAAFPFGGRASSDYAYNRVRQQLDELLDSLKDFTPHFLPPNEQQPATSLAFLDGATDIIHRLPNWDTFQHNRHKQEAYEEMAKAWAIVIREAAKKAGGIQLQYGGWDEKIAKHNEISGGKMQEAVNELRGGLGWMGAETSNSAAGAPADAMSIRQQLLSGNYGAGSPASIGAW

STS1

Tethering factor for nuclear proteasome STS1

309 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

35.668 kDa

MTLTNQMDFQNHFLAKDLHRITKPKKVGKRRHTDESNDEDASKPRFMPKTLSKLAQHKKQRQPQVMGQKLSVSRIIETLDQESLQNLISNLVSEHPEVAPTLLKISPQVTIEDSLMVLEQKLERILQNMPYRVDASSDYSFLRVKPHVEDFFQTLSDYTLNFLPPIESDLTVPLMFLMKFLAKCFPRLPKFHAVEYRYYHSLTVDKFNTILDDILVQFLSEKKHNIILAINQDWLTDFRKISELNDNNFSSVYERLKQEIDQYENPDAASGQPSTNNAGRLTGLANLLNFSSDNSPLHGNTVGNVFDTI

STS1

Tethering factor for nuclear proteasome STS1

308 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.98 kDa

MNVLLSPQPPLFQHPHETNRISPSRSLSPFHNMSTSRKRKADEDGDEMSMSPRSSPAASSRQLQRPSKKVRSNELVGRPLTLPRLLETLDPTALRTVLERICERHPDIGQEVVNSAPRPTVAAAHGVLQEYQDKMKAAIPYGETSPDYTYYRVKAPMTALIDALLDFTPQYLPPNETQTTVSLQYMDGATKIIHALPDWEPQQYRHHKENAYDEISKAWALVINEAAKRGGGLSLHTGGWDQTLAKHHEISGGRMGTAMNAMATSVSWMAHGGSSNGQQPGNPSSDQNSILNQLMSGTYGAPVRVGPW

STS1

Tethering factor for nuclear proteasome STS1

307 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.875 kDa

MMMHTRKRIFRSPATGPQVQFTDPFSVSPYNNMASRKRKADDDNDDMSVSPLSSPALPSRPIVRPSKKIRQANDDVAARPLSLPRLLETLTNDQLRTVLQTICERHPDIGHEVVTSAPRPTVACALDILAGYQEKLHDATPLGHTNSDYAYFRVKQQLGALLDAISDFTSQFLPPLEQQTNISLQFLDGVTKVIHELPDWENQSHRHHKDAAYDEISAAWALVITEASKRGGGFIVHTGGWDQRLVKHNQQSGGKMGQAINALAVEVGWQGQNPITDTPAPSGRDPNSILNQLINGAYGSPVRVGPW

STS1

Tethering factor for nuclear proteasome STS1

306 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.892 kDa

MNAIHGSFTPPHLLNNRHSPTRNIYPSSAMTGRKRKADDDGSSDDRMSASPSISSAELPRQQPRHMKRMRTNLSGRPLPLPRLLETLSADEMRNLLQSICQRHPDIGNEVVSTAPRPSIQSTLEVLSKYESAFQSAFPFGGRASSDYAYNRVRQQLIELLESLKDFTPHYLPPNEQQSATSLAFLDGATEIIHRLPNWDTYQHNRHKEEAYEEMAKAWAIVFREAAKKAGGIQLQYGGWDQKIAKHNEHSGGKMQEAVNELRGGLGWMGADAPAPAASGPEDAMSIRQQLLSGNYGMGSSASIGAW

sts1

Tethering factor for nuclear proteasome sts1

305 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.256 kDa

MNVLLPTQASFFSSPHRNPIHTPVSPHTNHRMVGRKRKADDDGLDDNMSISPTNSPSLATRQIPRPSKKVRANEISGRPLSLPRLLETLDAQSLRSVLQTICERHPEIGSEIVTSAPRPSVASTLGVLSKYQNELQGAFPYGGSPGSDYAYDRVKQQLTNLIDALVDFTPHYLPPNEQQTAISLSFLDSATKIVHDLPNWDSQSHRHHKDNAYDEISRAWALVISEASKRGGGFQLHSGGWDQTLARHNEQSGGKMQMAVNALGSNLGWMGGNSGVGSGDPDSIRNQLLSGRYGTNQSVPVGAPW

sts1

Tethering factor for nuclear proteasome sts1

304 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.483 kDa

MNVLLSPQPPFFPHQHEPSRRSPPRIMSQHTMASRKRKADDDDNEMSISPTGSPAINSRQLSRPSKKVRAGIELAGRPLPLPRLLETLDKSQLRAVLQTICERHPGIGHEVMVSAPRPSVNGALEVLGEYQDKLRAAIPFGNSSSEYTYFRVKQPLMALVDALGDFTPQFLPPVEQQATVSLEYLNHATKIVHDLPDFDSQQYRHHKDGAYDEISRAWALVITEAAKRGGGFHLHNGKWDQVLAKHNQQSGGKLEQAMNAMVNEVGWVGANSNAHGQGSSSDPNSILNQLINGTYGAPVQVGPF

STS1

Tethering factor for nuclear proteasome STS1

304 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.737 kDa

MNVLLSPQPLFFPHQHEPSRRSPPRTMSHYTMTSRKRKADDDDNEMSVSPTGSPAINPRQLSRPSKKVRAGIELAGRPLPLPRLLETLDKTQLRAVLQTICERHPDIGHEVMTSAPRPSVNGALEVLGEYQDKLRAAIPFGNSSSEYTYYRVKQPLMALVDALGDFTPQFLPPVEQQTTVSLEYLNHATKIIHDLPDFDSQQYRHHKDGAYDEISRAWALVITEAAKRGGGFHLHNGKWDQVLAKHNQQSGGKLEQAMNAMVNEVGWIGANQNAHGQGSSSDPNSILNQLINGTYGAPVQVGPF

STS1

Tethering factor for nuclear proteasome STS1

301 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.214 kDa

MNVLLSPQPPVFPHHHENPRLSPQRSVSPLLGMSNRKRKADDDGDETMSPLSSPAISARPLVRPSKKVRSNELIGRPLPLPRLLETLDASQLRMVLERLCERHPDIGQEVVVGAPRPSVLSALDVLQDYHVKLKEAIPYGESSPEYTYYRVKEPLIALIDALSDFTPQYLPPMETQPTTSLQFLDGATKLIHDLPNWEPQAYRHHKESAYDDISRAWALVITEAGKRGGGLNLHTGGWDQTLSRHNEQSGGRLGTAMSAMASSVGWMGPGLSTQGNPSEQNSILNRLMSGSYGSPVRVGPW

STS1

Tethering factor for nuclear proteasome STS1

299 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.458 kDa

MSQSVGFNWGFKPSTAENTSSAISTCKVTKPRVKRRFAGEEAASGGSPTYNNRPRAVAKRRTAVSGIQGQPLPLSRALELMDRTQLQSTLLELVKLHPEIQSTFMALQPPSRGLDQYVTLLRGKLEQVYANLPYSRLRDRLPDDTGEGLNDYTFVRVKSFLLEFLNCLVDCLLESIPPQVQNPLHSLKLLDTATGLLSQLPHFSTASNNYYKNVCYEQVAEIWSTVIRQATQDISFLGATSTVLDWLQILQKHNEKSQGKLQRPLSLLQTFQESLEPVQAPAGISQDQQQPSNLWNNIV

STS1

Tethering factor for nuclear proteasome STS1

296 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

32.729 kDa

MNVLLSPQPPVFPHQHENHHLSPQRSLSPFHNMATRKRKADEDGDETMSPRSSPTISSRPLARPSKKIRANEVIGRPLALPRLLETLDTAQLRTVLERICERHPDIGHEVETGAPRPSVSSVVVVLQGYMEKLSNAVPYGETSPEYTYYRVKEPLVALIDALSDFTPQFLPPNETQPTKSLEFLNEATNIIHKLPDWEPQTYRHHKENAYEEISKAWALVINEAGKRAGGINLHSGGWDQILSRHNEQSGGRLAYAISAMTTSVGWLDPSTSSGPAGASDPNSILNQLMSGIMGLA

STS1

Tethering factor for nuclear proteasome STS1

292 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

32.841 kDa

MMGSVVPLSSPAWDLNLSAGQNLLGHGSPTPSHSRKRRLSVTPEAGDSHMEHESPSKPRQQSPFVHKRARVTRQLQSRPLPMSRLLSSLDQKTLVSLLEGICAQDDRVARQVMEVTPKPTVSSAMDVLSRALDQAFALFPYKGDHQNDYAFFRVRPALEEFLAELSDYLSHFLPPNETQVSNSFAFLDQATSLVHRMPQWSSPANNRLKEETYEHIDVAWTLVCEEAAKRQRGSLAMSGVGNWLIRLEKHNELSGDRLKTSLHLLRDMLDDQGYRPPNPFASFNGAQQLFTV

STS1

Tethering factor for nuclear proteasome STS1

291 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

33.421 kDa

MSSLQTSFPWGFKKAVISKPTKNKRKIQEDIDTLGDAKSRTKFHPNNSNSTSRKHRTHAIMGTKLPLNTLIETLDHESLQKLVKSLVEQRPDVQEALYNAAPTVTVQVCIDKLTDKVENIKCNLPYKVDTECDYTYLRVKALVHEFFQALSDYMLNFLPPQEYDVSKSIEFLNGFLLKVLLKMPMFSHMEFKYYYKLTLDKLNTVYVNLIADFIQQKPTNILLLKDSDLAEKLLEINKHYEDYFEQVSQLLSQDEGSDIPERLQGLSNLLNFSSENNPLNGGVVSSVKGSW

STS1

Tethering factor for nuclear proteasome STS1

280 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

32.351 kDa

MSGQMFWGKKEDGKRKRSFQESYETPKVQKCVRKRRPALNVQGQPLPPQRSLEMMSKDQLMSVLMEVMRQHPEVGSTFQAKVSSYQFASEKYQQLLKGKVEQLYSNIPYNRSYDNTNLDDYAFVRMKPYITELLNCLVDCALDNLPPRKSDLHESLKFLESCTQLVLDLPRFESGSNNYYYDKCLEQISHLWCSLIEQISKDIHMVMNTNMEEWITKLNAYNERSNGLLTSAVTLFKSLASDGDLLGDQQNEMESPAYVAGPGLLLESNPSYLMHNKYSM

STS1

Tethering factor for nuclear proteasome STS1

259 amino acids

Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

28.918 kDa

MSTPAFSLRNPENHARCAKPLRKRKLSPPQIDTPRSFSPSRQKRAKTTKILGQSLPVHRIIETLDRNALQSLLQQVAAANPQVAQSIVDLAPKPDTKDALAVMRAKFDAITAHLPYKCSAESDYSYTRVKPYLCEFLSTLSDFILNMLPPLEVDLQPACTILDAITEMIHKLPNFSNSEFQYTRAMAYDQLSTSWQILLDAADERLLVRVEAEMGLSRRLQKHNELSGGKLTQAVESAGRGQSPLLGGLITVDYSSFRH