Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity).

Belongs to the cut8/STS1 family.

312 amino acids

MNSLVATPPVPPHFYEYSRLSSSRPMSTPTYTPNSRKRKADDDGNDHDGRMSASPTSSPAFTPRSLPSRNMKRARPNVSGRPLSLPRLLETLDTDALRGVLRSMCERHPGLVDEVVHTAPRPSVSSALQVLRNYQSTLQSSFPLGGNPASDYAYNRVRQPLSNLLDALSDFTPHFLPPNEIQPSLSLNYLDGATEIIHALPRWHTPQNNIERDSAYDEICKAWILVIREAAKRGGGIQLQYGGWDQKLAKHNQNSGGKLQAAVNELGASLGWMHGPETQSHASPGGNDFGSIREQLLSGTYGLGTPVKVGPW

34.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sts1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here