SSN3

Serine/threonine-protein kinase SSN3

713 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

77.024 kDa

MSDQIRASGYFYSQTDDPFAAAFWSQFQDPHVLAARHIPADSSASAAMKAYREYRDRVRKPVLATYTILGFLSSGTYGRVYKARLRTPPQLASSSGTAGIANANAGTGSGTATVGSGASTAKKRGGLLQQHQLLDSPSSSLHATPKSVADGAGVGVNGTPSASPSLSASLGTSTANAPGGSDNTLQLSSNELPDTQIYAIKKFKPDSKETDATIYTGISQSAMREISLNRELSHVNIVTLHQVMLEDKAIYMVFEYAEHDLLQIIHYHSTALRAPIPLAVLKSLLWQLINGVAYLHANWILHRDLKPANILVTSQGVVKIGDLGLARLYSSPLQSLYNGDKVVVTIWYRAPELLLGARHYTTAIDMWSVGCIWGELLALRPMFKGEEAKMDPKTKAAPFQTDQLKRIVEVLGTPNKDRWPAIESMPDYKGWWPHLRLDNYPKTLSRWYATRNKGDDGYELFNSLLQYDPEQRLTANQALEHAWFTAQDPKPTANAFSSLAKPHATYPNRRVIQDDMDPKMKSNYVPPIKSHHMQPWHQVNLNSSQPHRLAQLMYQQEQMRHQQMQTQAPAPAPAQPPAATAVTGRLGHAVGAGSSAVGTAANVGGPAAPPPIAIGSTAGTGGAIGIQSSAASTAPSQHMYNNNPLITIAGTNGGTISNPATVRSSHSIGSTESITPTTSSQPIPAQPSSAPLARTTNLVATATRNQQRKRQRN

SSN3

Serine/threonine-protein kinase SSN3

608 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

68.962 kDa

MSYSSASFRKLNNVGISQPSQTTTTTTSANQPQSQSQQQPLQQSQQQHLHMKPNPHIPHHQLPGTVGTRTSIPQPALMASNSILTLGPFKHRKDLTRESVLSTYQIMGYIAAGTYGKVYKAKLKSNKLNKTDDDSGIDGINNKDIFSESMNDLHHDNSSSIMINTTTNITINNSLPQFFAIKKFKSDNHHHHINNNNNGGNHLSKGNNSIHQDEVLHYTGISQSAIREMSLCRELNNKNITKLVDIILENKSIYMVFEFCEHDLLQIIHYQSHPDFKPIPCPTIKSLIWQILNGVTFLHKNWILHRDLKPANIMVSSQGVVKIGDLGLARKFKSPLQSLYTGDKVVVTIWYRAPELLLGTRHYTPAVDLWAVGCILAELLSLRPIFKGEEAKIDLNNKKSVPFQKNQLQKIIEILGTPTTDIWNNLNKYPEYLSFTQHFNQNYPNNLSNWFKLINGGNNQNSEKCLELLSGLLKYDPELRLTADQALLHPYFLELPKVNENAFEGLNYKYPNRKIYTDDNDIMTTAANNNNNNNNNNNNNNNNNNNNNNNNNNNSGHQLSQQQNVQIQQVHQMQQQIHSQQLQSHGANSTYKRSGIDDLPGGIRKKRG

SSN3

Serine/threonine-protein kinase SSN3

593 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

67.013 kDa

MYGNQQNNSNPYQMSYYRMNNGQGQGTNRWPQQLSHQEMLAGHSQQILNNNKPAGNQSKPPIVMASNNVFSIGPYRQRKDSSRISVLQKYEIIGYIAAGTYGKVYKAKARDYQNGMNRDNVIILDSPDSVSADSNLDINSINRSTRQQEANDNLTTMDFRKPSHKRFTPPNNSNSTQIRSNSGSETNVRINSSSITNNSRKPSQIQFYAIKKFKTEREGVEHYTGISQSACREMSLCRELDNNHLTKLVEIFLEKKSIYMVSEFAEHDLLQIIHFHSHPEKRLIPPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFNNMVQTLYTGDKVIVTIWYRAPELILGARHYTPAIDLWAVGCIFAELIGLRPIFKGEEAKMESKKSVLFQANQFQKILEVMGSPDHKIWPNIDSYPEYLQLAKMPKYRDNLTAWYQTAGGKDKTALDILYRLLQYDPIKRIDAIDALDHVYFTNGDPPVCENVFEGLNYKYPPRRIHTNDNDITNVGNDNNQANHSQKQPMHGNNNNKNGNMNGLGVNKRILAAAAAAAAAAAVSGNGNNPTSNTATGGSARKKRK

SSN3

Serine/threonine-protein kinase SSN3

581 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

64.53 kDa

MGIRLQSSDSMNNQHQTQQNKYFNVSNQASTRSLWSQQQQQQLLDTKGSASTSKSPMLMANNNVFSIGPYRQRKDAGRVSVLEKYEIIGYIAAGTYGKVYKAKAKETQEEQENSIHTHNQTLGSVSVAGIDGGMASREVENGGDDPLRLDGHGGIAVAPAAGGGLSSAAAHRARSNGAVKALPKKSAFTPFYAIKKFKTEREGVEQLHYTGISQSACREMSLCRELDNKHLTKLVEIFLERKSIYMVSEFAEHDLLQIIHFHSHPEKRLIAPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFYNLVQTLYTGDKVVVTIWYRAPELLLGARHYSPAIDLWAVGCIFAELIGLRPIFKGEEAKMDSKKSVPFQGNQLQRILEVLGTPTHHTWPNIHKYPEYEQLSKFSKYRDNLSVWYHSSGGRDKAALSLLYSLLKYDPITRIDAIDALEHEYFTNNDPPVSSDVFEGLSYKYPPRRIHTSDNDIMNVGANKNKSGFNHHPPQQQTVNNNGVTNSSIGGLGVNRRILAAAAAAAAAVQVNGTNIVSGSSSSNGPIRKKKR

SSN3

Serine/threonine-protein kinase SSN3

567 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

63.532 kDa

MQNSGRDLWQNQSGYMSSLQQGLNKSNMVGASTSHGKTPMLMANNDVFTIAPYRTRKDNARVSVLDKYEIIGYIAAGTYGKVYKAKSRQSSKSSSSTGSDSLAQDTKPTTEFSNTSSLQNAGTYGDMMGAHGPNSNNISAGGNTNPELSTRNNPNNPRVPTSTIISGDKRNSENTDNRRKAETTMYYAIKKFKTEKDGIEQLHYTGISQSACREMALCRELDNNHLTKLVEIFLQKKSIYMVYEFAEHDLLQIIHFHSHPEKRMIPPRMIRSIMWQILDGVSYLHQNWVLHRDLKPANIMVTMDGVVKIGDLGLARKFSNMLQTMYTGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAELIGLQPIFKGEEAKMDSKKTVPFQANQLQRILKILGTPTPKSWPHLQKYPEYEQLSKFPKYRDNLPGWFHSAGGRDKHALSLLYHLLNYNPIERIDAINALDHSYFTHGDMPVCENVFEGLNYKYPARRIHTNDNDILNLGLHKPKVPAKVVQPTMNNSTATLGGLGVNKRILAAAAAAAAAVSGNSSSQSSRNMEPMKKKRK

SSN3

Meiotic mRNA stability protein kinase SSN3

555 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II RPB1 at serines 2 and 5. The SSN3/SRB10 and SSN8/SRB11 kinase-cyclin pair may also positively and negatively regulate numerous transcriptional activators in response to changes in nutritional and physiological conditions. Phosphorylates GCN4, promoting its ubiquitin-mediated degradation, and MSN2, promoting its nuclear exclusion. Phosphorylates STE12, thereby promoting its degradation and inhibition of filamentous growth. Phosphorylates GAL4, and this phosphorylation is required for efficient galactose-inducible transcription. Also phosphorylates BDF1 and the TAF2 subunit of the TFIID complex.

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

62.847 kDa

MYNGKDRAQNSYQPMYQRPMQVQGQQQAQSFVGKKNTIGSVHGKAPMLMANNDVFTIGPYRARKDRMRVSVLEKYEVIGYIAAGTYGKVYKAKRQINSGTNSANGSSLNGTNAKIPQFDSTQPKSSSSMDMQANTNALRRNLLKDEGVTPGRIRTTREDVSPHYNSQKQTLIKKPLTVFYAIKKFKTEKDGVEQLHYTGISQSACREMALCRELHNKHLTTLVEIFLERKCVHMVYEYAEHDLLQIIHFHSHPEKRMIPPRMVRSIMWQLLDGVSYLHQNWVLHRDLKPANIMVTIDGCVKIGDLGLARKFHNMLQTLYTGDKVVVTIWYRAPELLLGARHYTPAVDLWSVGCIFAELIGLQPIFKGEEAKLDSKKTVPFQVNQLQRILEVLGTPDQKIWPYLEKYPEYDQITKFPKYRDNLATWYHSAGGRDKHALSLLYHLLNYDPIKRIDAFNALEHKYFTESDIPVSENVFEGLTYKYPARRIHTNDNDIMNLGSRTKNNTQASGITAGAAANALGGLGVNRRILAAAAAAAAAVSGNNASDEPSRKKNRR

SSN3

Serine/threonine-protein kinase SSN3

512 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

56.984 kDa

MNNHYHPTGHRDAKTYAGDRPWPQWPGVPSGLSSSSGLLQNRYYAPAGPFPLLPYFGELGAGPDTAMNQAKRQRAEVSYQQPRPYPTGRGTGSMGYQSKVRVTDKYKVVGFISSGTYGRVYKALGRHGQPGEFAIKKFKPDKEGEQASYTGISQSAVREMALCSELHHPNVIRLVEIILEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPNTIKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSSGEVKIGDLGLARLSYKPLHSLYGGDKVVVTIWYRAPELLLGSRHYTPAIDMWALGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPTKERWPLLTSTTEYSQLSTLQPPIHHGGHHGHHYQSQRQAAAANAGVSHLEKWYYNTINQQTGGSGPGSGTSPLASLGAEGYKLLAGLLEYDPQRRLTAAAALQHPFFSTGDPVSANCFEGLKTEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDSLRPGKRVKEG

SSN3

Serine/threonine-protein kinase SSN3

499 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

55.094 kDa

MSHSNPPTGASGGPGSASASAAPARGYYSLKRSIQTAFNDPLDRGLGPPAYQSKVRVMDKYQVIGFISSGTYGRVYKARGRQGQPGEFAIKKFKPDKEGEQITYTGISQSAIREMALCSELRHPNVIRLVETILEDKAIFMVFEYAEHDLLQIIHHHTQQPKHPIPPQTIKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSSGEVKVGDLGLARIFWKPVRTLMQGDKVVVTIWYRAPELLMGSHHYTPAVDMWAVGCIFAELLSLRPIFKGEEAKMDNTKKGGSRDMPFQRHQMQKIVDIMGMPTKERWPLLTSMPDYDKLPLLQPPLSASGYSQQPAHSHHHHQHYNQGPQYGGRAGGPTSSSSANSSSAAAAASQSHLDKWYYHTVSQGQTAGPMPHAPPGSLASLGVEGYKLLAGLLEYDPEKRLTAAAALQHNFFSTGDRVSANCFEGCKAEYPHRRVSQEDNDIRTGSVPGTKRSGMPDDSMGRPGKRVKE

SSN3

Serine/threonine-protein kinase SSN3

472 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

53.783 kDa

MNSGYNPGNANHITSHSNRTKNGVPTIPQPALMASNAILTIGPYKHRKDLIRESVLTKYQIIGYIAAGTYGKVYKAKSKTNGNSNSNSALMNDNVISIGNGQKEAGLQKTNNESMEDKNQLFAIKKFKSDNHSNKNNHDINGNEVIHYTGISQSAIREMSLCRELSNKNITKVVDILLENKSIYMVFEYCEHDLLQIIQYHSHPDVKPIPDFTIKSITWQILNGVTFLHKNWIFHRDLKPANIMVSSSGVVKIGDLGLARKFNNPLQSLYTGDKVVVTIWYRAPELLLGARHYTPSIDLWAVGCILAELLSLRPIFKGEEAKIDMNNKKSVPFQKNQLQKIVEVLGTPTTKNWPTITKYPEYSAFQQHFSNTYPPNLISWYKLIGRTSKQCLNLLRCLLEYDPTIRITADDALTHAFFLELPKMSENSFEGLSQKYPKRRIYTHENDIVSNSQHVNNKRHGYDDNMTRKRQR

SSN3

Serine/threonine-protein kinase SSN3

467 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

51.863 kDa

MSFSNLPPSSGRGSHADGASGRSMPPFPGSSSFTANNPSKGIHPNLTLKRSVQSFDESLDNKKPLPFSYASKVKLREKYLIVGFISSGTYGRVYKAKGRDGVGGDFAIKKFKPDKEGEKVEYTGLSQSAIREISLCTELNHPNVVRLVETILEDKCVYMVFEYTEHDLLQIIHHHTQPQRHAIPAPMVKSILFQLLNGLLYLHSQWVMHRDLKPANILVTSKGAVRIGDLGLARVFKKPLNSLFSGDKVVVTIWYRAPELLLGARHYTTAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMLKIIEILGLPKKEKWPGLSSMPEFPQLQAMAMAPGSGHLHKPSNLEHWYHVCLKSGGYSGSSPAGSPGKEGFDLLSRLLEYDPEKRISAKEALNHPYFTTGTPVAKNCFEGFEGKYPNRRVSQDDNDIRSGSLPGTKRSGLPDDTLTSRAAKRAREM

SSN3

Serine/threonine-protein kinase SSN3

466 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

52.124 kDa

MATIPGGGTIMDPMHLYRARRDKERRGVLKTYKILGFISSGTYGRVYKAVLLPPPKTASAKSALPSSTRAALSLPKDKLPSPSFTEDSDPLNNPEMCMRPGDRPAKRGDVFAIKKFKPDKEGDVLTYAGISQSGAREIMLNRELHHRNLVSLREVILEDKSIYMVFEYAEHDFLQIIHYHSQTARASIPPSTLRRLLHQLLCGVHFLHSNFVLHRDLKPANILVTSQGVVKIGDLGLARLWHKPLAQQGLYGGDKVVVTIWYRAPELILGAKHYTAAVDIWAVGCIYAELLSLRPIFKGDEAKMDGKKSLPFQRDQMGKICEVLGPVKPEQWPGIVHMPEYRTYQATGPYPHSNPLAPWYHARSNSSEGYDILVKMFEWDPARRITARDALRHPWFQEEGGVDTKSVFEGSSITYPTRRVTHEDNGDAKMGSLPQSMAGGRLPSSSNFRPASGNIVQPAARKKARI

SSN3

Serine/threonine-protein kinase SSN3

466 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

52.124 kDa

MATIPGGGTIMDPMHLYRARRDKERRGVLKTYKILGFISSGTYGRVYKAVLLPPPKTASAKSALPSSTRAALSLPKDKLPSPSFTEDSDPLNNPEMCMRPGDRPAKRGDVFAIKKFKPDKEGDVLTYAGISQSGAREIMLNRELHHRNLVSLREVILEDKSIYMVFEYAEHDFLQIIHYHSQTARASIPPSTLRRLLHQLLCGVHFLHSNFVLHRDLKPANILVTSQGVVKIGDLGLARLWHKPLAQQGLYGGDKVVVTIWYRAPELILGAKHYTAAVDIWAVGCIYAELLSLRPIFKGDEAKMDGKKSLPFQRDQMGKICEVLGPVKPEQWPGIVHMPEYRTYQATGPYPHSNPLAPWYHARSNSSEGYDILVKMFEWDPARRITARDALRHPWFQEEGGVDTKSVFEGSSITYPTRRVTHEDNGDAKMGSLPQSMAGGRLPSSSNFRPASGNIVQPAARKKARI

SSN3

Serine/threonine-protein kinase SSN3

450 amino acids

Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity). Required for normal growth and secondary metabolism.

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

50.892 kDa

MPLRPHIGLGFPAHAYQKRHVEPHDRSTGYQPKVRITDRYRIIGFISSGTYGRVYKAVGRNGKPVGEFAIKKFKPDKEGEQISYTGISQSAIREMSLCSELHHINVIRLCEIVLEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPATIKSIMFQLLNGCQYLHINWVLHRDLKPANIMVTSSGEVKIGDLGLARRFDKPLHSLFSGDKVVVTIWYRAPELILGSYHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFRRNQMQKIIEIMGVPTKDKWPLLSTMPEYNQLNTLANSMASSHHNHHSHHHPHHHHGHYGSRNPPPPGGSNLEKWYYSTINHTSAPGGTPPLASLGSEGYKLLAGLLEYDPSKRLTAAQALQSPFFSTGDRVSANCFEGCKNEYPCRRVSQDDNDIRTSSLPGTKRSGLPDDSLIRPAKRQKE

SSN3

Serine/threonine-protein kinase SSN3

443 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

49.756 kDa

MERKRGREMNPPSADPPSATPVARANLPGSVAAAFHGRPCSQGTTTLKRVNERYKIVGFISSGTYGRVYKAEGKNGRTGEFAIKKFKPDKEGELQYSGISQSAIREMALCTELAHPNVVHTVEIILEEKCIFIVFEYAEHDLLQIIHHHNQPQRQAIPARTIKSILYQLLQGLVYLHRNWVMHRDLKPANIMVTSAGKVKIGDLGLARLFYKPLQSLFSGDKVVVTIWYRAPELLLGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVEIMGMPSKDRWPLLTAMPEYPQLSSLIAGNAARFARPQGGDGLDRWYNQTLINNQYPAGPGPETPGAEGLALLKQLLEYDPQKRLTAEKALEHRYFTEHGKPSDNCFEDSKIKYPVRRVSQEDNDIRTSSLPGTKRSGLPDDSLMGRPAKRLKEG

ssn3

Serine/threonine-protein kinase ssn3

435 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

49.087 kDa

MYGRNFPFFNSLGGFYPRGNGFPLDAPSLDPRKPSGTGYTSKVRVRDKYRIVGFISSGTYGRVYKAIGKNGEKREFAIKKFKPDKEGEIIQYTGLSQSAIREMSLCSELDHPNVVQLEEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPAPMVRSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAIRVGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIEIMGLPTKEIWPGITSMPEFSQLQSLAMSRAPHFNRSSNLENWYQSCLKNGGYSANSSAGTPGADGFDLLSRLLEYDPTKRITAREALEHPYFKNGGPISANCFEGFEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRASKRIKE

SSN3

Serine/threonine-protein kinase SSN3

431 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

49.251 kDa

MASNSILTLGPFKHRKDLTRESVLSTYQIIGYIAAGTYGKVYKAKLKNTASAEQLFAIKKFKSDNHSSNRSHHNHDINGNEIVHYTGISQSAIREMSLCRELNNKNITKLVDIILENKSIYMIFEFCEHDLLQIIHYHSHPEVKPIPQATVKSLIWQILNGVTFLHQNWIFHRDLKPANIMVSSSGVVKIGDLGLARKFNNPLQSLYTGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCILAELLSLRPIFKGEEAKIDINNKKSVPFQKNQFQKIVEVLGTPSMKNWPALNKYPEFISFQQQLTTNYPPNLVNWYKMIGSSNKQCLELLKGLLEYDPLVRLTADNALVHPYFLELPKVQENAFEGLNLKYPKRRIYTDDNDIISNQAINQNFKRHGGAYDDQHNNSNNNTNNSLNANNANNVPRKRAR

ssn3

Serine/threonine-protein kinase ssn3

427 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

48.037 kDa

MFGRSFPFYNSLGGFYPQSLDARKPPGSGYTSKVRVRDRYHIVGFISSGTYGRVYKAIGKNGQKGEFAIKKFKPDKEGEIIQYTGLSQSAIREMALCSELDHPNVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPALMVRSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIEIMGLPTKEIWPGIVSMPEYSQLQSLAMSRAPGHFNRSSNLEGWYQSCLKNNGYSANSSAGTPGADGFDLLSRLLEYDPTKRITAQEALEHPYFKNGGPISANCFEGFEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLLGRATKRLKE

ssn3

Serine/threonine-protein kinase ssn3

426 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

48.039 kDa

MLGRNFPYFNSVGGFYSRENSRRQPGTGYTSKVRVRDKYHIVGFISSGTYGRVYKAVGRNGQGGEFAIKKFKPDKEGDIIQYTGLSQSAIREMALCSELDHANVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHPIPAAMVRSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIDIMGLPHRDNWPGIVHMPEYSQLQSLAMSRAPNHISRTSNLGSWYQNCLKNGGYSVNSSVGTPGDDGFDLLSRLLDYDPTSRITAKEALEHPYFKNGGPISANCFEGFEGKYPHRRITHDDNDIRSGSLPGTKRSGLPDDSLMSRAAKRMKE

ssn3

Serine/threonine-protein kinase ssn3

426 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

48.039 kDa

MFGRNFPFFNSIGGFYPRESLDSKRPSGTGYTSKVRVRDKYHIVGFISSGTYGRVYKAIGKDGRKGEYAIKKFKPDKEGEIIQYTGLSQSAIREMALCSELDHPNVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPAPMIKSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAVRIGDLGLARLFYKPLNSLYSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIDIMGLPRKETWPGLVSMPEFSQLQSLAMSRGYLNRQCNLEGWYQSCLKNNGYSPGSAAGTPGAEGFDLLSRLLEYDPTKRISAREALEHPYFTTGTPVTANCFAGYEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRAAKRLKE

ssn3

Serine/threonine-protein kinase ssn3

426 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

48.035 kDa

MFGRNFPFFNSIGGFYPRDSLDPRKPSGTGYTSKVRVRDKYHIVGFISSGTYGRVYKAIGKDGRKGEFAIKKFKPDKEGEIIQYTGLSQSAIREMSLCSELDHSNVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPAPMIKSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAVRIGDLGLARLFYKPLNSLYSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIVEIMGLPRKETWPGLVAMPEFSQLQSLAMARGHLNRQSNLEGWYQSCLKNNGYSPTSSAGTPGPEGFDLLSRLLEYDPLKRISAQEALEHPYFTTGTPITANCFAGYEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRAAKRLKE

ssn3

Serine/threonine-protein kinase ssn3

426 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

48.025 kDa

MFGRNFPFFNSIGGFYPRESLDSKRPSGSGYTSKVRVRDKYHIVGFISSGTYGRVYKAIGKDGRKGEYAIKKFKPDKEGEIIQYTGLSQSAIREMALCSELDHPNVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPAPMIKSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAVRIGDLGLARLFYKPLNSLYSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIDIMGLPRKETWPGLVSMPEFSQLQSLAMSRGYINRQCNLEGWYQSCLKNNGYSPGSAAGTPGAEGFDLLSRLLEYDPTKRISAREALEHPYFTTGTPVTANCFAGYEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRAAKRLKE

ssn3

Serine/threonine-protein kinase SSN3

413 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

46.348 kDa

MLKEHLDPRKPSGTGYTSKVRVRDKYHIVGFISSGTYGRVYKALGKNGQKGEFAIKKFKPDKEGEIIQYTGLSQSAIREMALCSELDHANVVQLEEIILEDKAIFMVFEYTEHDLLQIIHHHTQPHRHAIPAPMVRSILFQLLNGLLYLHTSWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIEIMGLPTKDIWPGIVSMPEYSQLQSLAMSRAPGHFPRSSNLEGWYQSCLKNGGYATSSGAGTPGADGYDLLSRLLEYDPTKRITAQEALEHPYFKNGGPISANCFEGFEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRASKRLKE

SSN3

Serine/threonine-protein kinase SSN3

405 amino acids

Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

46.29 kDa

MSNYRRGVGSYSRMLGGGTNPFAAYTARKAKTKKRVLDKYEIIGYIAAGTYGRVYKARSKDPGDTNQYAIKKFKADKEGEMVHYAGISQSACREVALCAELDNRNITKLVETILEDTCIYMVFEYAEHDLLQIIHYHSHPERKPIPEYTLKSILWQLLNGVSYLHQNWVLHRDLKPANTMVTSDGVLKIGDLGLARLFSNPLQSLYSGDKVVVTIWYRAPELLLGARHYSPAVDLWAVGCIFAELLALRPIFKGEEAKMDNKTNVPFQRNQMQKIIEILGSPQEDDWPSLSKFPEYESLKQMKTFPPNLEAWYQSIGGTNQKGFQLLSRLLEYDPAKRLTANDALLHPYFTEAPKVSQNVFERQEYKYPPRRISCEDSDIKTMTYQGTKRGSQGGDNLHPRKKQK