Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

512 amino acids

MNNHYHPTGHRDAKTYAGDRPWPQWPGVPSGLSSSSGLLQNRYYAPAGPFPLLPYFGELGAGPDTAMNQAKRQRAEVSYQQPRPYPTGRGTGSMGYQSKVRVTDKYKVVGFISSGTYGRVYKALGRHGQPGEFAIKKFKPDKEGEQASYTGISQSAVREMALCSELHHPNVIRLVEIILEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPNTIKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSSGEVKIGDLGLARLSYKPLHSLYGGDKVVVTIWYRAPELLLGSRHYTPAIDMWALGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPTKERWPLLTSTTEYSQLSTLQPPIHHGGHHGHHYQSQRQAAAANAGVSHLEKWYYNTINQQTGGSGPGSGTSPLASLGAEGYKLLAGLLEYDPQRRLTAAAALQHPFFSTGDPVSANCFEGLKTEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDSLRPGKRVKEG

57 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SSN3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here