scnn1b

Amiloride-sensitive sodium channel subunit beta

651 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

74.207 kDa

MFLKRWFIRALHRLQKGPGYGYSELFVWYCNNTNTHGPKRLIIEGPKKKTLWSLFTVTFACLVFWQWGLLIQTYLSWGVSVSLSVGFRGMDFPAVTVCNVNPFKYSKVKPLLKELDELVDILLEQFYSYSTNGTLPVVFPDMRSSYLTGDPPPWYQIPLVMIDETDADNPTVTNVLGTDALSPTNNSTTNSSTEARRYKVAFHLCNTNGTDCFYKNFSSSLEAVKEWYTLQYIDIISKLPLSQKVEMGYSGKDFILTCLFGGEACNYDNFTQFYHSSYGNCYVFNWGLDGNVLIVSNPGVGFGLQLALDVNQEEYIPFLTTRAGARFLLHTQNTFPFVETMGTYALVGTVTSVGILVDEVQRMGQPYGTCTTDGLDVPIDNLYSQYNLSYTMQSCLWSCFQIQMVNSCGCAYYLYPLPEGATYCNNQNNSDWAYCYYLLQDSKDHKNECLQTCIQTCNELQFRISTSMADWPSESSEDWIFHVLSYERDDSTNITMKRDGVLKLNLYFKEFNYRVITESVATNVVWLLSNLGGQFGFWMGGSVLCIIEFGEVFIDCIWIAVIRFVKWYKNRKERQVQAQYADPPPTVSELVEGYTNQGFQPDIINSCSPQAQPPDLYLPTTLEIPGTPPPKYDSLRVHPIDTEHHSDSEDL

SCNN1B

Amiloride-sensitive sodium channel subunit beta

650 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

73.56 kDa

MLLHINPAYLFKLLHGFPPWIMPTDGNLGDKNFQMGKPGHREGATMHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFTALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTRSSASEKICNAHGCKMAMRLCSLNGTQCTFRNFTSATQAVTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQDFDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPNEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

SCNN1B

Amiloride-sensitive sodium channel subunit beta

641 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

72.654 kDa

MHLKKYLLKGLHRLQKGPGYSYKELLVWYCNNTNTHGPKRIICEGPKKKAMWFLITLLFTSLVCWQWGVFIRTYLSWEVSVSLSLGFKTMDFPAVTICNASPFQYSKVKHLLRDLDELMEAVLERILAPEHSDANATRTLNVTMWNYTPLVLIDEQNPHCPVVLDLFGDIHNGSASSSPAPARSCTVHGCKVAMRLCSLNGTVCTFRNFTSATQAVTEWYLLQATNIFSQVPQRELVEMSYPAERLILACLFGAEPCSYRNFTSIFHPDYGNCYIFNWGMTEKALPSANPGAEFGLKLILDIGQEDYVPFLTSTAGARLMLHEQRSYPFIKDEGIYAMSGTETSIGVLVDRLERKGEPYSQCTVNGSDVPVRNLYSDYNTTYSIQACIRSCFQDHMIQNCSCAHYLYPLPRGERYCNNREFPDWAYCYSHLRMSVAQRETCINMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGVVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEILIDFVWITIIKLVAFAKSLRQKRAQARYAGPPPTVAELVEAHTNFGFQPDVARPGPDPGTYPDEQTLPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

SCNN1B

Amiloride-sensitive sodium channel subunit beta

641 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

71.973 kDa

MHVKKYLLKCLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIIREGPKKKAMWFLITLLFASLVCWQWGVFIKTYLSWEVSVSLSMGFKAMDFPAVTICNASPFRYSKVRHLLKDLDELMEAVLARILAPESSQANATAAMNLSMWNYTPLVLIDERDPHHPVVLDLFANDPTGSASSSPGPRGACNAQGCKVAMRLCSLNGTSCTFRNFSSATQAVTEWYALQATNIFSQVPQRELVELGYSAERLILACLFGAEPCSYRNFTSIFYPDYGNCYVFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIREEGVDAMSGTETSIGVLVDKLQRKGEPYSPCTVNGSDVPVQNLYGSYNTTYSIQACLHSCFQTQMIASCQCGHYLYPLPRGQEYCNSRDFPDWAPCYLALRMSEAERETCIRMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNVTLSRKGVVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFAEIIIDFVWITIIKLVALAKGLRQRQAQARYAGPPPTVAELVEAHTNFGFQPDVGHRSPDAEAYPDEQALPIPGTPPPNYDSLRLQPLDVVESDSEGDAV

SCNN1B

Amiloride-sensitive sodium channel subunit beta

641 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

72.677 kDa

MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFVLTLLFTSLVCWQWGLFIKTYLNWEVSVSLSIGFKTMDFPAVTICNASPFQYSKVQHLLKDLDELMEAVLGRILGPELSQVNDTRALNLSIWHHTPLVFINEQNPHHPVVLDLFEDNFNGSASNSPAPGRPCSAHRCKVAMRLCSHNGTTCTFRNFSSATQAVTEWYTLQATNIFAQVPNQELVAMGYPAERLILACLFGAEPCNYRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLILDMGQEDYVPFLTSTAGARLMLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYSQCTKNGSDVPIQNLYSNYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPHKRKYCNNQEFPDWAHCYSALRISLAQRETCIYACKESCNDTQYKMTISMAVWPSEASEDWIFHVLSQERDQSSNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSVRQKRAQARYEGPPPTVAELVEAHTNFGFQPDLATPGPDVEAYPHEQNPPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

SCNN1B

Amiloride-sensitive sodium channel subunit beta

640 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

72.659 kDa

MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

Scnn1b

Amiloride-sensitive sodium channel subunit beta

638 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

72.197 kDa

MPVKKYLLKCLHRLQKGPGYTYKELLVWYCNNTNTHGPKRIICEGPKKKAMWFLLTLLFACLVCWQWGVFIQTYLSWEVSVSLSMGFKTMNFPAVTVCNSSPFQYSKVKHLLKDLDELMEAVLEKILAPEASHSNTTRTLNFTIWNHTPLVLIDERNPDHPVVLNLFGDSHNSSNPAPGSTCNAQGCKVAMRLCSANGTVCTLRNFTSATQAVTEWYILQATNIFSQVLPQDLVGMGYAPDRIILACLFGTEPCSHRNFTPIFYPDYGNCYIFNWGMTEETLPSANPGTEFGLKLILDIGQEDYVPFLASTAGARLMLHEQRTYPFIREEGIYAMAGTETSIGVLVDKLQRKGEPYSPCTMNGSDVAIKNLYSVYNTTYSIQACLHSCFQDHMIRNCSCGHYLYPLPEGEKYCNNRDFPDWAYCYLNLQMSVTQRETCLSMCKESCNDTQYKMTISMADWPSEASEDWILHVLSQERDQSSNITLSRKGIVKLNIYFQEFNYRTIEESPANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFIWITIIKLVASCKGLRRRRPQAPYTGPPPTVAELVEAHTNFGFQPDTTSCRPHGEVYPDQQTLPIPGTPPPNYDSLRLQPLDTMESDSEVEAI

Scnn1b

Amiloride-sensitive sodium channel subunit beta

638 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

71.995 kDa

MPVKKYLLKCLHRLQKGPGYTYKELLVWYCNNTNTHGPKRIICEGPKKKAMWFLLTLLFACLVCWQWGVFIQTYLSWEVSVSLSMGFKTMNFPAVTVCNSSPFQYSKVKHLLKDLYKLMEAVLDKILAPKSSHTNTTSTLNFTIWNHTPLVLIDERNPDHPVVLNLFGDSHNSSNPAPGSTCNAQGCKVAMRLCSANGTVCTFRNFTSATQAVTEWYILQATNIFSQVLPQDLVGMGYAPDRIILACLFGTEPCSHRNFTPIFYPDYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGARLMLHEQRTYPFIREEGIYAMAGTETSIGVLLDKLQGKGEPYSPCTMNGSDVAIQNLYSDYNTTYSIQACLHSCFQDHMIHNCSCGHYLYPLPAGEKYCNNRDFPDWAYCYLSLQMSVVQRETCLSMCKESCNDTQYKMTISMADWPSEASEDWILHVLSQERDQSSNITLSRKGIVKLNIYFQEFNYRTIEESPANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFIWITVIKLVASCKGLRRRRPQAPYTGPPPTVAELVEAHTNFGFQPDTTSCRPNAEVYPDQQTLPIPGTPPPNYDSLRLQPLDTMESDSEVEAI

SCNN1B

Amiloride-sensitive sodium channel subunit beta

632 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

71.112 kDa

MHLKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFVLTLLFTSLVCWQWGLFIKTYLNWEVSVSLSIGFKTMDFPAVTICNASPFQYSKVQHLLKDLDALMEAVLGRILGPELSQVNATTALNLSIWHHTPLVFINEQNPHHPVVLDLFEDNFNGSASSSPAPGRPCSARRCKVAMRLCSHNGTTCTFRNFSSATQAVTEWYTLQATNIFAQVPNQELVAMGYPAERLILACLFGAEPCNYRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLILDMGQEDYVPFLTSTAGARLMLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYSQCTKNGSDVPIQNLYSSYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPDKRKYCNNQEFPDWAHCYSALRISMAQRETCIYACKESCKLLGTSPPLPPCLLPPVSPQDWIFHVLSQERDQSSNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSVRGPPPTVAELVEAHTNFGFQPDSAMPGPDAGAYRREQNPPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

SCNN1B

Amiloride-sensitive sodium channel subunit beta

607 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

69.198 kDa

MNLKKYFIRVLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIIREGPKKKFIWFFLTLLFASLVFWQWGILITTYLSYSVSSSLSIGFKTMKFPAVTVCNASPFKYSKVRHLLRELDELTEAALERILQSKNRDATSALPLNSSETPSQTLNLRLWNQIPLVLIDESDPERPVIIDLFETDESGSGAQPNNSSPALVNVTSEAKKQKVAMKLCSRKALPNCIYRNFTSAAQAVTEWYILQSTSIFAKIPRNETVEMGYQPEDMILACLYGAEPCSYRNFTPIYHPDHGNCYIFNWGKDEEALFSSNPGAEFGLKLILDISQQDYIPYLTSTAGARLMLHEQRSFPFLKDLGIYAMSGTETSIGVLVDELERMGFPYSDCTMNGSDVPVKNLYNEYNTTYSIQACLRSCFQAQMFETCGCGHYLFPLPEGVSYCNSEDDPDWAYCYSSLRSSIGHRQFCIDSCKETCNDIQYKMTISMADWPSEASEEFQYMQHPLTYERDQSRNATLDRNGIIKLNIYFQEYNYRTISESAATTIVWLLSSLGGQFGFWMGGSVLCLIEFGEIIIDFLWITVIKISNWGKGLKQKRARAQYPDAPPTVSELVEAHINL

SCNN1B

Amiloride-sensitive sodium channel subunit beta

273 amino acids

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.

31.214 kDa

single

NCYIFNWGQEGQELLESANPGADFGLKMVLDIDQKEYIPFLQSTAAARIILHQQRSFPFLKDLGIYAMPGTETSIAVLEDQTQHLEAPYSSCTVDGSDIPVANIYSKFNSSYSIQSCLRSCFQEIMVKYCKCAYYLFPLLNGAHYCNNQEDPDWVPCYYNIWDTVSHREQCINMCQQPCNDSNYKMTISMADWPSAAAEDWIFHVLSYEKDTSLDITVNRDGIMRLNIYFEEFNYRSISESPTTNVVWLLSNLGGQFGFWMGGSVLCIIEFGE