About Products Protein Database Contact

Protein expression services for SCNN1B | Amiloride-sensitive sodium channel subunit beta

Description
Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
Family
Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.
Species
Bos taurus
Length
641 amino acids
Sequence
MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFVLTLLFTSLVCWQWGLFIKTYLNWEVSVSLSIGFKTMDFPAVTICNASPFQYSKVQHLLKDLDELMEAVLGRILGPELSQVNDTRALNLSIWHHTPLVFINEQNPHHPVVLDLFEDNFNGSASNSPAPGRPCSAHRCKVAMRLCSHNGTTCTFRNFSSATQAVTEWYTLQATNIFAQVPNQELVAMGYPAERLILACLFGAEPCNYRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLILDMGQEDYVPFLTSTAGARLMLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYSQCTKNGSDVPIQNLYSNYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPHKRKYCNNQEFPDWAHCYSALRISLAQRETCIYACKESCNDTQYKMTISMAVWPSEASEDWIFHVLSQERDQSSNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSVRQKRAQARYEGPPPTVAELVEAHTNFGFQPDLATPGPDVEAYPHEQNPPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
Mass
72.7 kDa
Simulated SDS-PAGE
Western blot of SCNN1B recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make SCNN1B using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here