About Products Protein Database Contact

Rsph17025_1197

Gene
Rsph17025_1197
Protein
Deoxyguanosinetriphosphate triphosphohydrolase-like protein
Organism
Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Length
378 amino acids
Similarity
Belongs to the dGTPase family. Type 2 subfamily.
Mass
42.744 kDa
Sequence
MLAPYACQPGESRGRQQPESMSTFRSPFQRDRDRIIHSSAFRRLKHKTQVFVEHEGDYYRTRLTHSIEVAQVARTISGVLGLNTDLAECIALAHDLGHTPFGHTGEDALAKLMEPYGGFDHNAQAMRIVTRLERHYAEFDGLNLTWESLEGIAKHNGPVEGPLPYALAEANAQWDLELHTYASAEAQVAAIADDVAYSHHDLHDGLRSGLFTEDDLMELPVTAPAFAEVDALYPGLEPMRRRHEALRRVFGRMVEDVIAVAQGRLEAAQPKSVEEIRQMGATVIRFSKPLYQELKVIRSFLFHRMYRAPSVMKERAKVTAVVNDLFPLFMRQPELLPQEWRRDVEAAEDETTLARIVADYVAGMTDRFALQEHARLCG