About Products Protein Database Contact

Try expressing Rsph17025_1197 in cell-free | Deoxyguanosinetriphosphate triphosphohydrolase-like protein

Family
Belongs to the dGTPase family. Type 2 subfamily.
Species
Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Length
378 amino acids
Sequence
MLAPYACQPGESRGRQQPESMSTFRSPFQRDRDRIIHSSAFRRLKHKTQVFVEHEGDYYRTRLTHSIEVAQVARTISGVLGLNTDLAECIALAHDLGHTPFGHTGEDALAKLMEPYGGFDHNAQAMRIVTRLERHYAEFDGLNLTWESLEGIAKHNGPVEGPLPYALAEANAQWDLELHTYASAEAQVAAIADDVAYSHHDLHDGLRSGLFTEDDLMELPVTAPAFAEVDALYPGLEPMRRRHEALRRVFGRMVEDVIAVAQGRLEAAQPKSVEEIRQMGATVIRFSKPLYQELKVIRSFLFHRMYRAPSVMKERAKVTAVVNDLFPLFMRQPELLPQEWRRDVEAAEDETTLARIVADYVAGMTDRFALQEHARLCG
Mass
42.7 kDa
Simulated SDS-PAGE
Western blot of Rsph17025_1197 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing Rsph17025_1197 in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here