RITA1

RBPJ-interacting and tubulin-associated protein 1

269 amino acids

Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis (By similarity).

Belongs to the RITA family.

28.911 kDa

MKTPVELAVSGIQTLPLQHRCRGSHRVKARASYVDESLFGSPAGTRPTPPDFDPPWVEKANRTSGVGTGTSRASGANGSCETTSSSGSTPTLTPRKKNKYRLISHTPSYCDESLFGSRPEGTNWEGPWMAKGDAAKLHSLFWTPPATPRGSHSPRPRETPLRAIHPAGPSKTEPKVAADSQKLSTDGLDSPHPLRRERSHSLTHLNVPRTGRPPTSGPHTNGPRDPRPSPSGVTLQSPLVTPRARSVRISVPATPQRGGATQKPKPPWK

RITA1

RBPJ-interacting and tubulin-associated protein 1

269 amino acids

Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis (By similarity).

Belongs to the RITA family.

29.087 kDa

MKTPVELAISGMQTLHVQHRGRSGYRVKVRPSYVDETLFGSPAGTRPVPPDFDPPWMKKANRSRGVGTGVSQALGANGSCESTSSSGSTPTLTPRKKNKYRLISHTPSYCDESLFGSRQEGAGWEAKWMARGDAAKLHALFWTPPATPRGSHSPRPRETPVRCVHPADLSKTEHRVMASSRRLSVDGLDTPRPLRRERSHSLTHPNVPSTGHTPASSPCTSGPRDPRPAPSGVTFRSPLVTPRAGSVSVSVPTTPRQGGATQKTKPPWK

RITA1

RBPJ-interacting and tubulin-associated protein 1

269 amino acids

Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis.

Belongs to the RITA family.

28.619 kDa

MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEASKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSEGASFGAPRMAKGDAAKLRALLWTPPPTPRGSHSPRPREAPLRAIHPAGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPSTGHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK

Rita1

RBPJ-interacting and tubulin-associated protein 1

258 amino acids

Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis (By similarity).

Belongs to the RITA family.

28.148 kDa

MQALHLQHRNPRSYRVKARASYVDETLFGSPTGTRPTLPDFDPPWVQNCNRSRGVSPGPPKVSLAKRDCESPSSRGSTPNLTPRKKNKYRLIGHTPSYCDESLFGSRPQGTSKERSRTAVEDAAKLRTLFWTPPATPRGSHSPRPRETPLRAIHPTGPPRTEPRVATGSQMVSRDGLDAPRSLGQRRSYSLTHLAVPSTGHPASTAPQTNGPWSPRPYTSGATVQSPLVTRKVCSGSVSGPTTPQRGACPQKPKPPWK

Rita1

RBPJ-interacting and tubulin-associated protein 1

253 amino acids

Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis (By similarity).

Belongs to the RITA family.

27.071 kDa

MKALHLQHRSPTSYRVKARASYVDETLFGSPARTRPAQPDFDPPWVQNCNRSRGVGPGPPKGSLAKRDCESPSSRGSTPNLTPRKKNKYRLIGHAPSYCDESLFGTSKEGSRMAVGDAAKLRTLFWTPPATPRGSHTPCPRETPLRAIHPAGPSRTEPRVTAGSQMSSQDGLCVPCSLGQRRSHSLTHLTVPSTGHPASSAPQTNGPWSPRPNTSGATVQSPLVTSKACSGRVSGPAPPRRGACPPKPKPPWK

rita1

RBPJ-interacting and tubulin-associated protein 1

239 amino acids

Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of rbpj/rbpsuh, thereby preventing the interaction between rbpj/rbpsuh and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis.

Belongs to the RITA family.

26.637 kDa

MPDNLYATNMSLDLSITGHSTALPQRKSRSTYRFKAANSYVDESLFGSSGVRVDQTLQWNTAPPSQTPLLWSPGEIKENKKTSSCRPKSTPAGTPRKKIQYRVKSRTPSYCDESLFGGKVEECTWDAPWVKKEDTVKIRPLLWSPSPRLVQQSSMQNAKQGPLRAVHPPETSDSPLGTHKGLGAFWKPPESDSDYSPSPFSARQRQSTPGRETVRSASCSGRVTARRGSVKMQERPPWK