Description
Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of rbpj/rbpsuh, thereby preventing the interaction between rbpj/rbpsuh and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis.
Family
Belongs to the RITA family.
Sequence
MPDNLYATNMSLDLSITGHSTALPQRKSRSTYRFKAANSYVDESLFGSSGVRVDQTLQWNTAPPSQTPLLWSPGEIKENKKTSSCRPKSTPAGTPRKKIQYRVKSRTPSYCDESLFGGKVEECTWDAPWVKKEDTVKIRPLLWSPSPRLVQQSSMQNAKQGPLRAVHPPETSDSPLGTHKGLGAFWKPPESDSDYSPSPFSARQRQSTPGRETVRSASCSGRVTARRGSVKMQERPPWK
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service