RIPPLY3

Protein ripply3

190 amino acids

Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of TBX1. Plays a role in the development of the pharyngeal apparatus and derivatives (By similarity).

Belongs to the ripply family.

20.368 kDa

MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK

ripply3

Protein ripply3

170 amino acids

Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of tbx1 that plays a key role in pharyngeal development. Plays a role in the formation of the anteroposterior (AP) axis during embryonic development; required to establish the posterolateral border of the pre-placodal ectoderm (PPE) acting downstream of the retinoic acid receptor (RAR) signaling.

Belongs to the ripply family.

18.941 kDa

MDSSQYMLKATLTQMCLCSRGVRNVHSEHPQQQDSSLTLWRPWLLGAGDRELDGQQRRSGEADGVPTNTGPKGALGFQHPVRLYMPKSKTSEYLQHMGRKVLASFPVQATIHFYNDDSDSEEEDEEEEMEFYNYYQNCAANGVDSSRGSSDNYSVQGGPKRNIGSHAGSA

Ripply3

Protein ripply3

152 amino acids

Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of TBX1. Plays a role in the development of the pharyngeal apparatus and derivatives.

Belongs to the ripply family.

16.965 kDa

MRPEAAGVREARGRLCHCPGDDPGRLPLPRGPESSIPAPWRPWMSPPPGDAELTRTERPCESWGDQHTSGSKGAFGFQHPVRLYLPVSKRQEYLQSSGEKVLASFPVQATIHFYNDDSESGSEEEQEEEAQPNHLQCLEAEVRDSAQEERAE

ripply3

Protein ripply3

110 amino acids

Probable transcriptional regulator involved in developmental processes.

Belongs to the ripply family.

12.477 kDa

MLPVCVDADQALRCSVLWRPWSLSPTEARGHKTLAGGVRSARPSGGVFHHPVRLFLPRSRMQEYLSRLGSSVLASFPVQATLHFYNDEDSSSEEEEDEEHANTRCRLWRP