Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of tbx1 that plays a key role in pharyngeal development. Plays a role in the formation of the anteroposterior (AP) axis during embryonic development; required to establish the posterolateral border of the pre-placodal ectoderm (PPE) acting downstream of the retinoic acid receptor (RAR) signaling.

Belongs to the ripply family.

170 amino acids

MDSSQYMLKATLTQMCLCSRGVRNVHSEHPQQQDSSLTLWRPWLLGAGDRELDGQQRRSGEADGVPTNTGPKGALGFQHPVRLYMPKSKTSEYLQHMGRKVLASFPVQATIHFYNDDSDSEEEDEEEEMEFYNYYQNCAANGVDSSRGSSDNYSVQGGPKRNIGSHAGSA

18.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ripply3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here