qcr7

Cytochrome b-c1 complex subunit 7

137 amino acids

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping (By similarity).

Belongs to the UQCRB/QCR7 family.

16.03 kDa

MKPVSLAKYIQKSPFLTKLLLPISNAYVHLSGYRKYGLRYDDLMLEENDDTQKALSRLPKMESYDRVYRIRRAMQLSIENKILPKSEWTKPEEDYHYLRPVLAEVIAERKEREAFDALIVKKPETQAHATSSPAHAH

QCR7

Cytochrome b-c1 complex subunit 7

128 amino acids

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping (By similarity).

Belongs to the UQCRB/QCR7 family.

14.656 kDa

MASITSVVKTSELILKSPLLSKIVVPLAKTYVKFSGYRQLGFKMNDLIIEETPNMQLALRRLPPTESYDRVYRLIRATQFSLSHKLATGNDITKPEEDDHYLIPYILDVEAEAFEKDALDNLEVVKRK

QCR7

Cytochrome b-c1 complex subunit 7

128 amino acids

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping (By similarity).

Belongs to the UQCRB/QCR7 family.

14.779 kDa

MPQSFTSIAKIGDFILKTPLLSKICVPVSKQYIKYSGYRKLGLRFDDLIAEENPIMQTALKRLPEGESYARNYRIIRAHQSELTKHLLPRNEWVKAQDDVPYLLPYILEAEAAAKEKEDLDNLELSKK

QCR7

Cytochrome b-c1 complex subunit 7

127 amino acids

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.

Belongs to the UQCRB/QCR7 family.

14.663 kDa

MPQTFTSIAKIGDYILRTPALAKVVVPIAHQFINLSGYRKMGLRFDDLIEEENELAQTALRRLPADESYARIYRIINAHQLSLSHHLLPKDKWTKPEDDIPYLTPYLLEAEAFVKEKEELDNLEVAK

QCR7

Cytochrome b-c1 complex subunit 7

127 amino acids

Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c. QCR7 is involved in redox-linked proton pumping.

Belongs to the UQCRB/QCR7 family.

14.565 kDa

MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK

QCR7

Cytochrome b-c1 complex subunit 7

126 amino acids

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping (By similarity).

Belongs to the UQCRB/QCR7 family.

14.531 kDa

MPQSFSSIVRMGDYILKSPTLSKIAVPVAQQFVKLSGYRQLGLKFDDLIAEENDIVQTALRRLPEEESYARVFRIIQAHQLELTHHLLPKHKWTKPEEDKSYLLPYLLEAEAAAKEKLELDALELK

QCR7

Cytochrome b-c1 complex subunit 7

126 amino acids

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.

Belongs to the UQCRB/QCR7 family.

14.129 kDa

MASHTSIVKAGDFILRTPVLRSIFVPAAKLFCAYSGYRQLGLKFDDLIHEENPTVQKALSRLPKDEIYARNFRMLTAAQCGITHHLLSADKALKPSEDTPYLLPYLLELEAEAAERVELDNVEVAK

QCR7

Cytochrome b-c1 complex subunit 7

126 amino acids

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping (By similarity).

Belongs to the UQCRB/QCR7 family.

14.284 kDa

MASITSIVKTADYILSRPVLSKVVSPVAKAFVAYAGYREMGLKFNDLLIEETPVMQKAISRLPDEEIYARNYRFITAHQCSLSHQLLPANQAVKPEEDTHYLVPYILEAEKEAFERAELDNIEVPN