This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.

Belongs to the UQCRB/QCR7 family.

127 amino acids

MPQTFTSIAKIGDYILRTPALAKVVVPIAHQFINLSGYRKMGLRFDDLIEEENELAQTALRRLPADESYARIYRIINAHQLSLSHHLLPKDKWTKPEDDIPYLTPYLLEAEAFVKEKEELDNLEVAK

14.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make QCR7 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here