PP16-1

16 kDa phloem protein 1

156 amino acids

Binds to both sense and antisense RNA (PubMed:29320165). Can also bind sheared DNA and dodecamer DNA with a low affinity (PubMed:29320165). Interacts with mesophyll plasmodesmata to mediate its own cell-to-cell transport and potentiate RNA trafficking (By similarity). May play a role in plant defense signaling (By similarity).

17.317 kDa

MAVGILEVSLISGKGLKRSDFLGKIDPYVEIQYKGQTRKSSVAKEDGGRNPTWNDKLKWRAEFPGSGADYKLIVKVMDHDTFSSDDFIGEATVHVKELLEMGVEKGTAELRPTKYNIVDSDLSFVGELLIGVSYSLLQDRGMDGEQFGGWKHSQVD

PP16-1

16 kDa phloem protein 1

150 amino acids

Binds to both sense and antisense RNA. Interacts with mesophyll plasmodesmata to mediate its own cell-to-cell transport and potentiate RNA trafficking.

16.588 kDa

MGMGMMEVHLISGKGLQAHDPLNKPIDPYAEINFKGQERMSKVAKNAGPNPLWDEKFKFLAEYPGSGGDFHILFKVMDHDAIDGDDYIGDVKIDVKNLLAEGVRKGKSEMPPRMYHVLAHKIHFKGEIEVGVSFKLQGGGGCGGCYPWEN