Protein expression services for PP16-1 | 16 kDa phloem protein 1
Description
Binds to both sense and antisense RNA (PubMed:29320165). Can also bind sheared DNA and dodecamer DNA with a low affinity (PubMed:29320165). Interacts with mesophyll plasmodesmata to mediate its own cell-to-cell transport and potentiate RNA trafficking (By similarity). May play a role in plant defense signaling (By similarity).
Species
Arabidopsis thaliana
Length
156 amino acids
Sequence
MAVGILEVSLISGKGLKRSDFLGKIDPYVEIQYKGQTRKSSVAKEDGGRNPTWNDKLKWRAEFPGSGADYKLIVKVMDHDTFSSDDFIGEATVHVKELLEMGVEKGTAELRPTKYNIVDSDLSFVGELLIGVSYSLLQDRGMDGEQFGGWKHSQVD
Mass
17.3 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make PP16-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here