pigF

S-adenosyl-L-methionine-dependent methyl transferase PigF

348 amino acids

Involved in the biosynthesis of 4-methoxy-2,2'-bipyrrole-5-carbaldehyde (MBC), one of the terminal products involved in the biosynthesis of the red antibiotic prodigiosin (Pig). Catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (SAM) to the hydroxyl group of 4-hydroxy-2,2'-bipyrrole-5-carbaldehyde (HBC) to yield 4-methoxy-2,2'-bipyrrole-5-carbaldehyde (MBC).

Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-independent O-methyltransferase family.

38.942 kDa

MTLTKQDAVNQMMGFFQSKTLITALSLKLFDHLRDQDRNAKQMAALLNCPLRSSEQLLIALQAMGYLEKQDGLYHLPQEHRAFLVSDEPQWLGWLGRHIDTFLYPLWGELKAAVENDTHQRQTVFGDDRSWFDILYQNPDDVTDFQEFLGKFAAPFIDGFIQDYDFSQHQAFLDIGSGIGSLPIAVANAYSGVNLAICELPQTSTFLRDKLVQQGYGQRIQVLEGDVISGDLPIGDYDLIHLGWMLHDYAPETQLIILKNIYDAMPVGGRFIASETPLNADKSGPEFTALLSLNMLVSTDGGIESSPQEYLSRFHQAGFSNARIMDISGPRTLIVGEKTTHNNGSSQC

PIGF

Phosphatidylinositol-glycan biosynthesis class F protein

219 amino acids

Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI.

Belongs to the PIGF family.

24.89 kDa

MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYLVVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN

Pigf

Phosphatidylinositol-glycan biosynthesis class F protein

219 amino acids

Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI.

Belongs to the PIGF family.

24.825 kDa

MKDTDIKRLLYTNLLCVFSIFLSIFIPSFFVDNFSVLEAHLTWLCICSASVTTVNLLSYLVVKPNVSSKRSSLSHKVTRALKCCVCFLMSCFLLHIIFVLYGAPLIELVLETFLFAVVLSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFTGAWLGAFPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN