Involved in the biosynthesis of 4-methoxy-2,2'-bipyrrole-5-carbaldehyde (MBC), one of the terminal products involved in the biosynthesis of the red antibiotic prodigiosin (Pig). Catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (SAM) to the hydroxyl group of 4-hydroxy-2,2'-bipyrrole-5-carbaldehyde (HBC) to yield 4-methoxy-2,2'-bipyrrole-5-carbaldehyde (MBC).

Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-independent O-methyltransferase family.

348 amino acids

MTLTKQDAVNQMMGFFQSKTLITALSLKLFDHLRDQDRNAKQMAALLNCPLRSSEQLLIALQAMGYLEKQDGLYHLPQEHRAFLVSDEPQWLGWLGRHIDTFLYPLWGELKAAVENDTHQRQTVFGDDRSWFDILYQNPDDVTDFQEFLGKFAAPFIDGFIQDYDFSQHQAFLDIGSGIGSLPIAVANAYSGVNLAICELPQTSTFLRDKLVQQGYGQRIQVLEGDVISGDLPIGDYDLIHLGWMLHDYAPETQLIILKNIYDAMPVGGRFIASETPLNADKSGPEFTALLSLNMLVSTDGGIESSPQEYLSRFHQAGFSNARIMDISGPRTLIVGEKTTHNNGSSQC

38.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pigF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here