Nedd8

NEDD8

84 amino acids

Ubiquitin-like protein which plays an important role in cell cycle control, embryogenesis and neurogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex Uba3-Ula1 and linkage to the E2 enzyme Ubc12. Attachment of Nedd8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.

Belongs to the ubiquitin family.

9.346 kDa

MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYKVQGGSVLHLVLALRGGDSILTPCV

NEDD8

NEDD8

81 amino acids

Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins (By similarity).

Belongs to the ubiquitin family.

9.072 kDa

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

NEDD8

NEDD8

81 amino acids

Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.

Belongs to the ubiquitin family.

9.072 kDa

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Nedd8

NEDD8

81 amino acids

Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.

Belongs to the ubiquitin family.

8.972 kDa

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLGQ

NEDD8

NEDD8

81 amino acids

Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins (By similarity).

Belongs to the ubiquitin family.

9.072 kDa

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Nedd8

NEDD8

81 amino acids

Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins (By similarity).

Belongs to the ubiquitin family.

8.972 kDa

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLGQ

nedd8

NEDD8

77 amino acids

Ubiquitin-like protein which plays an important role in cell cycle control, embryogenesis and neurogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex ube1c/uba3-ula1 and linkage to the E2 enzyme ube2m/ubc12. Attachment of nedd8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins (By similarity).

Belongs to the ubiquitin family.

8.515 kDa

MLIKVKTLTGKEIEIDIDPTDKIQRIKERVEEKEGIPPSQQRLIFGGKQMGDDKPASEYSIEGGSVLHLVLALRGGL