NDUFB2

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

108 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB2 subunit family.

12.282 kDa

MAGMSALKRLAPFAHVGGHLFRGRCARAAGARGVRRAGGGAHIEPRYRQFPQLTRSQVIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGIPPDDED

NDUFB2

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

105 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB2 subunit family.

12.111 kDa

MSALTRLASFARVGGRLFRSGRARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED

NDUFB2

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

105 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB2 subunit family.

12.058 kDa

MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED

Ndufb2

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

105 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB2 subunit family.

11.967 kDa

MSALTRLVPFGRVGGRLLRGCRARAAGDSGVRHAGGGVHIQPRYREFPQLTRSQVIQGEFLSSLMWFWILWRFWHDSDAVLGHFSYPDPSQWTDEELGIPPDDED

NDUFB2

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

105 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB2 subunit family.

12.156 kDa

MSDLTRLASFARVGGRLFRSGRARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED

NDUFB2

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

105 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB2 subunit family.

12.154 kDa

MSALIRLASFARVGGRLFRSGRARTAGDGGVRHASGGVHLEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSKWTDEELGIPPDDED