Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB2 subunit family.

108 amino acids

MAGMSALKRLAPFAHVGGHLFRGRCARAAGARGVRRAGGGAHIEPRYRQFPQLTRSQVIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGIPPDDED

12.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NDUFB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here