NCE102

Non-classical export protein 2

173 amino acids

Involved in membrane organization. Required for the formation of membrane compartments of CAN1 (MCCs), localization of CAN1 at the MCCs and subsequent invagination of the plasma membrane at the MCCs sites. Involved in eisosome organization and might act as a sensor of sphingolipids that regulates plasma membrane function. Involved in a novel pathway of export of proteins that lack a cleavable signal sequence. It may be an accessory subunit to an essential core component of the non-classical export machinery. Non-classical export pathway functions also as an alternative clearance/detoxification pathway to eliminate damaged material, when the basic repair pathway is not sufficient.

Belongs to the NCE102 family.

18.967 kDa

MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFANFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV

NCE102

Non-classical export protein 102

170 amino acids

Involved in membrane organization. Involved in a novel pathway of export of proteins that lack a cleavable signal sequence. Non-classical export pathway functions also as an alternative clearance/detoxification pathway to eliminate damaged material, when the basic repair pathway is not sufficient (By similarity). Regulates actin organization and subsequent morphogenesis and pathogenesis.

Belongs to the NCE102 family.

18.123 kDa

MLAIGDVILRAFNFVFLVIALGLTGSLAATTITQHNPQINFAVFAAAFGLLTSSFYGVFAYFVAAFAWPVILFVFDFLNFVFTFAAATAIAAGIRAHSCSNQDYLDDNNIAQGSSGRCRKAQASTAFLYFSTFIFIASAIFSAISLSKGGLFGHSSRPAPRTGVPTMSQV