Involved in membrane organization. Involved in a novel pathway of export of proteins that lack a cleavable signal sequence. Non-classical export pathway functions also as an alternative clearance/detoxification pathway to eliminate damaged material, when the basic repair pathway is not sufficient (By similarity). Regulates actin organization and subsequent morphogenesis and pathogenesis.

Belongs to the NCE102 family.

170 amino acids

MLAIGDVILRAFNFVFLVIALGLTGSLAATTITQHNPQINFAVFAAAFGLLTSSFYGVFAYFVAAFAWPVILFVFDFLNFVFTFAAATAIAAGIRAHSCSNQDYLDDNNIAQGSSGRCRKAQASTAFLYFSTFIFIASAIFSAISLSKGGLFGHSSRPAPRTGVPTMSQV

18.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NCE102 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here