MOCS3

Adenylyltransferase and sulfurtransferase MOCS3

464 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.

In the N-terminal section; belongs to the HesA/MoeB/ThiF family. UBA4 subfamily.

50.574 kDa

MMSNGGDSSEIVRELEELKLKKAEIEHRISTLEAKLQDTAAVELYDAVSNGDSYLTAPELEHGLSPDQIYRYSRQLLLPSFAVEGQSNLLKSSVLVIGAGGLGSPALLYLAACGVGQLGIIDHDVVELNNMHRQIIHTEAFIGHPKVKSAAAACRSINSTIKVDEYVEALRTSNALEILSQYDIIVDATDNPPSRYMISDCCVLLGKPLVSGAALGMEGQLTVYNHNGGPCYRCLFPTPPPTSACQRCSDSGVLGVVPGVIGCLQALETIKLASLVGEPLSERMLLFDALSARMRIVKIRGRSSQCTVCGDNSSFNKQTFKDFDYEDFTQFPLFAGPLNLLPAESRISSKEFKEILQKKEQHVLLDVRPSHHYKIVSLPDSLNIPLANLETRLNELTSALKEKGNGHANTESCTNPSVFVVCRRGNDSQRAVQYLRESGFDSAKDIIGGLEAWAANVNPNFPTY

MOCS3

Adenylyltransferase and sulfurtransferase MOCS3

460 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.

In the N-terminal section; belongs to the HesA/MoeB/ThiF family. UBA4 subfamily.

49.669 kDa

MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY

Mocs3

Adenylyltransferase and sulfurtransferase MOCS3

460 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.

In the N-terminal section; belongs to the HesA/MoeB/ThiF family. UBA4 subfamily.

49.375 kDa

MAAPEDVAALQAEITRREEELASLKRRLAAALTAEPEPERPLRVPPPPLAPRAALSRDEILRYSRQLLLPELGVRGQLRLAAAAVLVVGCGGLGCPLAQYLAAAGVGRLGLVDHDVVETSNLARQVLHGEAQAGESKARSAAAALRRLNSAVECVAYPRALAEDWALDLVRGYDVVADCCDNVPTRYLVNDACVLAGRPLVSASALRFEGQMTVYHHDGGPCYRCVFPRPPPPETVTNCADGGVLGAVPGVLGCAQALEVLKIAAGLGSSYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCGQQPTVTRLQDYEAFCGSSATDKCRALKLLCPEERISVTDYKRLLDSGAPHVLLDVRPQVEVDICRLPHSLHIPLSQLERRDADSLKLLGAALRKGKQESQEGVALPVYVICKLGNDSQKAVKVLQSLTAVPELDSLTVQDIVGGLMAWAAKIDGTFPQY

mocs3

Adenylyltransferase and sulfurtransferase MOCS3

459 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers urm1 and mocs2a. Its N-terminus first activates urm1 and mocs2a as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to urm1 and mocs2a to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards urm1 and mocs2a. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; nfs1 probably acting as a sulfur donor for thiocarboxylation reactions (By similarity).

In the N-terminal section; belongs to the HesA/MoeB/ThiF family. UBA4 subfamily.

50.798 kDa

MDDTIVSLKSQLLEREREVATLKKKLDQIEKGNSTLPELQEKVTSLSPLRLNTSLNNDDIMRYSRQLLLPELGVKGQIAISNISVLVVGCGGLGCPLAQYLAAAGIGRLGLLDYDVVELSNLHRQVLHTELTQGQPKALSAAQAISRMNSTVQCVPYHLQLSRENAIQLIQQYDIVADCSDNVPTRYLVNDACVLTSRPLVSASALRMEGQLTVYNYRGGPCYRCLYPIPPPPETVTNCSDGGVLGVVPGIMGCLQALEVLKIASGQECSFAQQLLMFDGEQTRFRSIRLRSRQKECVVCGEKPTITELQDYEHFCGSAATDKCRRLHLLSREQRVSVQDYKGILDHSTPHLLLDVRPKVEVDICRLSNSLHIPLASLEDKKPEHITLLKEAISDLQEHLNNQSPVQVFVVCKLGNDSQKAVQLLEKMSGAEVEAMTVKDIGGGLMAWAKKIDYCFPQY

MOCS3

Adenylyltransferase and sulfurtransferase MOCS3

455 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.

In the N-terminal section; belongs to the HesA/MoeB/ThiF family. UBA4 subfamily.

48.834 kDa

MAAREEVLALQAEVAQREEELSSLKQRLAAALSTGQESARSVPVSPLPPRAALSREEIRRYSRQLVLPELGMQGQLRLAAAAVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEASNLARQVLHGEALAGQAKVFSAAAALRRLNSAVECVPYAQALTPATALDLVRRYDVVADCSDNAPTRYLVSDACVLAGRPLVSASALRFEGQLTVYHYGGGPCYRCVFPRPPPAETVTSCADGGVLGAVTGVLGCLQALEVLKTAAGLGPSYSGRLLLFDALRGDFRCIRLRRRRPDCAACGERPTVTDLQDYESFCGSSATDKCRSLRLLSPEERISIMDYKRLLDSRSPHLLLDVRPQVEVDICRLPHALHIPLKSLERRDAESLKVLGEAIREGKQGAQEGASVPIYVICKLGNDSQKAVKILQSWADLDSLTVKDVVGGLMAWAAKIDGTFPQY

MOCS3

Adenylyltransferase and sulfurtransferase MOCS3

455 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.

In the N-terminal section; belongs to the HesA/MoeB/ThiF family. UBA4 subfamily.

48.914 kDa

MAAREEVLALQAEVARREEELSSLKHRLAAALLAEQESERLLPVSPLPPKAALSQDEILRYSRQLVLPELGVQGQLRLATASVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEVSNLARQVLHGEALAGQAKVFSAAASLRRLNSAVECVPYAQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYGGGPCYRCVFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGLFRRIQLRRRRPDCAACGERPTVTELQDYEGFCGSSATDKCRSLQLLSPEERVSVIDYKRLLDSGSPHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLGEAIREGKQGTQEGASLPIYVICKLGNDSQKAVKILQSLPDLDSLLVQDVVGGLMAWAAKVDGTFPQY

mocs3

Adenylyltransferase and sulfurtransferase MOCS3

451 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers urm1 and mocs2a. Its N-terminus first activates urm1 and mocs2a as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to urm1 and mocs2a to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards urm1 and mocs2a. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; nfs1 probably acting as a sulfur donor for thiocarboxylation reactions (By similarity).

In the N-terminal section; belongs to the HesA/MoeB/ThiF family. UBA4 subfamily.

49.732 kDa

MDETDSQITCADSSVDKLSHLKRNEVKSCPLPELHGADEMLPELNKSCLTNPDILRYSRQLVLPDLGVQGQLKLSKASVLVIGCGGLGCPVAQYLAASGIGRLGLLDYDVVEMSNLHRQVLHGENRLGMSKSVSVAKTLRKLNSAVVYLPYHISLNPENALQIIQQYDIIADCSDNVPTRYLVNDTCVLAGKPLVSASALRWEGQLTVYNYHQGPCYRCLFPKPPPSETVTNCADGGVLGIVPGIIGSLQALEVLKIASGMAPSYSGVLLMFDALEGRFRNIKIRGKKNDCAACSNPSETAILQDYEAFCGSSASDKCRMLRLLSRDERLSVEEYKRLLDDHVPHILMDVRPQPEVDICRLPHSIHIPLKGLEEKNEKWVSFLRTKIAELITAGNRTEKTVITICKLGNDSQIAVKILQDLFGKEDLFIAKDVQGGLMAWAENIDPMFPRY

MOCS3

Adenylyltransferase and sulfurtransferase MOCS3

445 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.

In the N-terminal section; belongs to the HesA/MoeB/ThiF family. UBA4 subfamily.

48.308 kDa

MEGGGDDDGGRSRAEAIMRELERLRAEREELDGRIRLLESQLRLGAAPLPPSAAAEVEPTGSPSSSSSAAADMISRYRRHLLLPQFGLEGQRKLSQSSILVVGAGGLGSPVAMYLAACGVGCLGIVDGDRVELDNLHRQIIHIEAYVGQPKVKSTAASCRAYDIVVDATNNLPSRYMISDCCVLMNKPLISGSAVGLEGQLTVYHHNGSPCYRCLYPNPPSSPTSQSCSDNGILGILPGVIGCLQALEAIKVATAVGKPLCGRMLHFDALSSHTRIVKISRSSPTCKVCGENPVFTKEDFVNFDYESFTQSPMSKNSTTRSLNLLPENARVSCRDYKKVLDSGRPHLLVDVRPSHHFQIASMAHSINVPLSLLEEKLPLLRDSAREVSSRRDGRQHCPVYVICRRGNDSQVAVQILRENGFLYASDVAGGFESWAKEVDPSFLLY

mocs3

Adenylyltransferase and sulfurtransferase MOCS3

425 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers urm1 and mocs2a. Its N-terminus first activates urm1 and mocs2a as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to urm1 and mocs2a to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards urm1 and mocs2a. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; nfs1 probably acting as a sulfur donor for thiocarboxylation reactions (By similarity).

In the N-terminal section; belongs to the HesA/MoeB/ThiF family. UBA4 subfamily.

47.055 kDa

MEKYIKEHTLKPNEIERYGRQLITPDIGVSGQMSLCNSSVLIIGAGGLGCPVALYLSSAGIGTLGLVDYDTVEISNLHRQIGHRESSKGISKAVSLSKTISELNSLIKVNTYETTFTSETAMEIIKNYDIVVDASDNVATRYLVNDACVLTGKPLVSGSALKWEGQITCYNYNNGPCYRCIFPTPPPVETVTKCSDGGVLGPIVGVIGSLQALEVIKILTNNKEGVLSGRLLIYDGMSAVFRTVRIRGKQSGCNVCGDKPTVTQLIDYTQFCQSNYSESAGKVDDRVDKTLIITVEQFNQSIKNNNNNHLLIDVRPKIQFDICSLPNSNNIPIEEIDKKESIEIIEKLIKEKVENNNNNNNNNENRDASDELSVYLVCRRGNKSQDAVKILDEKLKEFRDKFKLLHIKDGLLGWNESIDDSFPIY