MFT1

THO complex subunit MFT1

392 amino acids

Component the THO subcomplex of the TREX complex, which operates in coupling transcription elongation to mRNA export. The THO complex is recruited to transcribed genes and moves along the gene with the elongating polymerase during transcription. THO is important for stabilizing nascent RNA in the RNA polymerase II elongation complex by preventing formation of DNA:RNA hybrids behind the elongating polymerase. It functions in cotranscriptional formation of an export-competent messenger ribonucleoprotein particle (mRNP) by facilitating the loading of ATP-dependent RNA helicase SUB2 and the mRNA export factor YRA1 along the nascent mRNA.

44.996 kDa

MPLSQKQIDQVRTKVHYSEVDTPFNKYLDILGKVTKLTGSIINGTLSNDDSKIEKLTEQNISQLKESAHLRFLDLQSSIDTKKVADENWETCQQETLAKLENLKDKLPDIKSIHSKLLLRIGKLQGLYDSVQVINREVEGLSEGRTSLVVTRAEWEKELGTDLVKFLIEKNYLKLVDPGLKKDSSEERYRIYDDFSKGPKELESINASMKSDIENVRQEVSSYKEKWLRDAEIFGKITSIFKEELLKRDGLLNEAEGDNIDEDYESDEDEERKERFKRQRSMVEVNTIENVDEKEESDHEYDDQEDEENEEEDDMEVDVEDIKEDNEVDGESSQQEDNSRQGNNEETDKETGVIEEPDAVNDAEEADSDHSSRKLGGTTSDFSASSSVEEVK

mft1

THO complex subunit mft1

202 amino acids

Component the THO subcomplex of the TREX complex, which operates in coupling transcription elongation to mRNA export. The THO complex is recruited to transcribed genes and moves along the gene with the elongating polymerase during transcription. THO is important for stabilizing nascent RNA in the RNA polymerase II elongation complex by preventing formation of DNA:RNA hybrids behind the elongating polymerase. It functions in cotranscriptional formation of an export-competent messenger ribonucleoprotein particle (mRNP) by facilitating the loading of ATP-dependent RNA helicase SUB2 and the mRNA export factor YRA1 along the nascent mRNA (By similarity).

23.282 kDa

MEETAIRSRLTVEERPLKRLISRCLGFAAQNVDEANLRDLEIEFSALSAFWLRLQMQLDMNAKEVDVYEGELKKTQTFCEAEKTEISQLEQDLLVAQEELRKREQYDELAKPIMSKGLRSRTEQQESIGKLQDAIRELEEENANYVKAWNLRKDIFDETLKQMNHLQSILHPPSNPESDSEEGIASEGENPSSSSSTQYKAK

MFT1

Protein MOTHER of FT and TFL1 homolog 1

176 amino acids

May form complexes with phosphorylated ligands by interfering with kinases and their effectors.

Belongs to the phosphatidylethanolamine-binding protein family.

19.207 kDa

MASHVDPLVVGRVIGDVVDLFVPTTAMSVRFGTKDLTNGCEIKPSVAAAPPAVQIAGRVNELFALVMTDPDAPSPSEPTMREWLHWLVVNIPGGTDPSQGDVVVPYMGPRPPVGIHRYVMVLFQQKARVAAPPPDEDAARARFSTRAFADRHDLGLPVAALYFNAQKEPANRRRRY