Component the THO subcomplex of the TREX complex, which operates in coupling transcription elongation to mRNA export. The THO complex is recruited to transcribed genes and moves along the gene with the elongating polymerase during transcription. THO is important for stabilizing nascent RNA in the RNA polymerase II elongation complex by preventing formation of DNA:RNA hybrids behind the elongating polymerase. It functions in cotranscriptional formation of an export-competent messenger ribonucleoprotein particle (mRNP) by facilitating the loading of ATP-dependent RNA helicase SUB2 and the mRNA export factor YRA1 along the nascent mRNA (By similarity).

202 amino acids

MEETAIRSRLTVEERPLKRLISRCLGFAAQNVDEANLRDLEIEFSALSAFWLRLQMQLDMNAKEVDVYEGELKKTQTFCEAEKTEISQLEQDLLVAQEELRKREQYDELAKPIMSKGLRSRTEQQESIGKLQDAIRELEEENANYVKAWNLRKDIFDETLKQMNHLQSILHPPSNPESDSEEGIASEGENPSSSSSTQYKAK

23.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mft1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here