MCAT

Malonyl-CoA-acyl carrier protein transacylase, mitochondrial

390 amino acids

Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1). This suggests the existence of the biosynthesis of fatty acids in mitochondria.

Belongs to the type II malonyltransferase family.

42.962 kDa

MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR

MCAT

Malonyl-CoA-acyl carrier protein transacylase, mitochondrial

390 amino acids

Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1). This suggests the existence of the biosynthesis of fatty acids in mitochondria.

Belongs to the type II malonyltransferase family.

42.962 kDa

MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR

Mcat

Malonyl-CoA-acyl carrier protein transacylase, mitochondrial

381 amino acids

Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1). This suggests the existence of the biosynthesis of fatty acids in mitochondria (By similarity).

Belongs to the type II malonyltransferase family.

41.928 kDa

MSARVARAGWAWRSWGRRAASSLREPPPDAVDVAELLRDSSVAEEGAQEAVARRRPPSQCSVLLFPGQGCQAVGMGSGLLHLPRVRQLYEAAHRVLGYDLLELCLRGPQEDLDRTVHCQPAVFVASLAAVEKLHHLQPAVIDNCVAAAGFSVGEFAALVFAGAMDFSEGLYAVKARAEAMQEASEAVPSGMLSVLGQRQSNFSFACLEAQEHCKSLGIENPVCQVSNYLFPDCRVISGHLEALQFLRRNSAKYHFRRTKMLPVSGGFHTCLMEPAVDPLMKVLGSINIKKPLVAVHSNVSGQKYTHPQHIRKLLGQQVVSPVKWEQTMHSIYERKKGMEFPSTYEVGPGQQLGSILKCCNRQAWKSYSHVDVMQNIMDPDP