Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1). This suggests the existence of the biosynthesis of fatty acids in mitochondria (By similarity).

Belongs to the type II malonyltransferase family.

381 amino acids

MSARVARAGWAWRSWGRRAASSLREPPPDAVDVAELLRDSSVAEEGAQEAVARRRPPSQCSVLLFPGQGCQAVGMGSGLLHLPRVRQLYEAAHRVLGYDLLELCLRGPQEDLDRTVHCQPAVFVASLAAVEKLHHLQPAVIDNCVAAAGFSVGEFAALVFAGAMDFSEGLYAVKARAEAMQEASEAVPSGMLSVLGQRQSNFSFACLEAQEHCKSLGIENPVCQVSNYLFPDCRVISGHLEALQFLRRNSAKYHFRRTKMLPVSGGFHTCLMEPAVDPLMKVLGSINIKKPLVAVHSNVSGQKYTHPQHIRKLLGQQVVSPVKWEQTMHSIYERKKGMEFPSTYEVGPGQQLGSILKCCNRQAWKSYSHVDVMQNIMDPDP

41.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mcat using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here