LSM1

Sm-like protein LSm1

172 amino acids

Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. The LSM1-LSM7 complex binds RNA with a preference for poly-U ends.

Belongs to the snRNP Sm proteins family.

20.307 kDa

MSANSKDRNQSNQDAKRQQQNFPKKISEGEADLYLDQYNFTTTAAIVSSVDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLEAMERIPFKEAWLTKQKNDEKRFKEETHKGKKMARHGIVYDFHKSDMY

lsm1

U6 snRNA-associated Sm-like protein LSm1

140 amino acids

Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. The LSM1-LSM7 complex binds RNA with a preference for poly-U ends.

Belongs to the snRNP Sm proteins family.

16.172 kDa

MNQATQIIPFTTSGSLVDYVDRKVIVVLRDGKKLIGILRSFDQFANLMLQYTIERIYVDDMYGDIDRGVYIVRGENVVLLGELDLDKEYDAVKQLRRMPAEELYPLAKLHEEEKKKNIREKGKYLHSVGFSVDGGHDDLY

LSM1

U6 snRNA-associated Sm-like protein LSm1

133 amino acids

Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated (By similarity). Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation (By similarity).

Belongs to the snRNP Sm proteins family.

15.193 kDa

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLEEY

LSM1

U6 snRNA-associated Sm-like protein LSm1

133 amino acids

Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated (PubMed:18172165). Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation (By similarity).

Belongs to the snRNP Sm proteins family.

15.179 kDa

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

Lsm1

U6 snRNA-associated Sm-like protein LSm1

133 amino acids

Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated (By similarity). Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation (By similarity).

Belongs to the snRNP Sm proteins family.

15.236 kDa

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVQQQTRLEAEKLKVQTLKDRGLSIPRADTLDEY

lsm1

Probable U6 snRNA-associated Sm-like protein LSm1

129 amino acids

Probably involved with other LSm subunits in the general process of degradation of mRNAs.

Belongs to the snRNP Sm proteins family.

14.812 kDa

MSSGLGDEVDKKLIVVLRDGRKFIGIMRTFDQFANIVLQDTIERIYVGDCYSDKNLGLFFIRGDNVVILGEIDPDKEVQEKKLKKISWDEITKAAALEKIKKEEEEQLKRRIMTESGLTIDSILNIDDF