Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. The LSM1-LSM7 complex binds RNA with a preference for poly-U ends.

Belongs to the snRNP Sm proteins family.

140 amino acids

MNQATQIIPFTTSGSLVDYVDRKVIVVLRDGKKLIGILRSFDQFANLMLQYTIERIYVDDMYGDIDRGVYIVRGENVVLLGELDLDKEYDAVKQLRRMPAEELYPLAKLHEEEKKKNIREKGKYLHSVGFSVDGGHDDLY

16.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lsm1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here