KRTAP7-1

Keratin-associated protein 7-1

87 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 7 family.

9.288 kDa

MTRYFCCGSYFPGYPIYGTNFHGTFRATPLNCVVPLGSPLNYGCGCNGYSSLGYSFGGSNINNLGGCYGGSFYRPWGSGSGFGYSTY

Krtap7-1

Keratin-associated protein 7-1

87 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 7 family.

9.516 kDa

MTRYFCCGNYFPGYPCYGTNFHGTYRATPLNCVVPLGSPLNHGCGTMYSSRNFCYGGISNFSNPGCCYGSSLYRPWGSGSGFGYSTY

KRTAP7-1

Keratin-associated protein 7-1

85 amino acids

In the wool cortex, wool keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant wool shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of wool keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 7 family.

9.078 kDa

MTRFFCCGSYFPGYPSYGTNFHRTFRATPLNCVVPLGSPLGYGCNGYSSLGYGFGGSSFSNLGCGYGGSFYRPWGSGSGFGYSTY