Description
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Family
Belongs to the KRTAP type 7 family.
Sequence
MTRYFCCGNYFPGYPCYGTNFHGTYRATPLNCVVPLGSPLNHGCGTMYSSRNFCYGGISNFSNPGCCYGSSLYRPWGSGSGFGYSTY
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service