KNSTRN

Small kinetochore-associated protein

316 amino acids

Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase (PubMed:19667759). Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture (PubMed:19667759, PubMed:22110139). The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments (PubMed:21402792). Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division (PubMed:23035123). May be involved in UV-induced apoptosis via its interaction with PRPF19; however, these results need additional evidences (PubMed:24718257).

35.438 kDa

MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPGVQPCRLVTMTSVVKTVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELLEKFRDNCLAILESKGLDPALGSETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQMEELQALKVKLEMKEERVRFLEQQTLCNNQVNDLTTALKEMEQLLEM

Knstrn

Small kinetochore-associated protein

312 amino acids

Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase. Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments. Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division.

34.728 kDa

MAAPEAEAQETAFRTTGPPTDSEPRPFPPSSRKFPFESAAADSNEDWAVAAEHYLKGSGENGGWEQPAPGVQPSHPATMASAKTVCDAQPHSMPSCGLPADTQTRATSKLPVKSKEADLLRHLHPGGPEPDVTKVTKSRRENGQVKAAETASRRNLRNSYKPFNKQKPEEELKDKNELLEAVNKQLHQKLTETQGELKDLTQKVELLEKFQDNCLALLESKGLNPGQETLASKQEPTTDHTDSMLLLETLKDELKVFNETAKKQMEELQALKVKLKLKEEESVQFLEQQTLCKDEASDFTIILEEMEQLLEM

Knstrn

Small kinetochore-associated protein

312 amino acids

Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase. Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments. Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division.

34.885 kDa

MATHKAEAQETDFRTTGPPTDLEQCPFPPSSRKFPFESVAADSTEGWAVAAEHHLKRSGEDGGWEQPASGVEPSRPTTMASSKTVCDAQPHSMPSCGLSADTQTRATSKLPVKSKDAEMLRHLHTGGLEPDVTKVTKPRRENGQGKAAETASRRNIRSSYKPLSKQKPEEDLKDKNELLEAVNKQLHQKLTETQGELKDLTQKVELLEKFQDNCLAILESKGLNSGQETQESKQEPSTDPTDSMLLLETLKDELKLFNETAKKQMEELQALKVKLKLKEKERIQFLEQQTLGKDEASDFTIILEEMEQLLEM