Description
Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase. Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments. Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division.
Sequence
MATHKAEAQETDFRTTGPPTDLEQCPFPPSSRKFPFESVAADSTEGWAVAAEHHLKRSGEDGGWEQPASGVEPSRPTTMASSKTVCDAQPHSMPSCGLSADTQTRATSKLPVKSKDAEMLRHLHTGGLEPDVTKVTKPRRENGQGKAAETASRRNIRSSYKPLSKQKPEEDLKDKNELLEAVNKQLHQKLTETQGELKDLTQKVELLEKFQDNCLAILESKGLNSGQETQESKQEPSTDPTDSMLLLETLKDELKLFNETAKKQMEELQALKVKLKLKEKERIQFLEQQTLGKDEASDFTIILEEMEQLLEM
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing Knstrn in a
cell-free protein expression systems? We have solved
cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.
Order Here