Kcne5

Potassium voltage-gated channel subfamily E regulatory beta subunit 5

143 amino acids

Potassium channel ancillary subunit that is essential for generation of some native K(+) currents by virtue of formation of heteromeric ion channel complex with voltage-gated potassium (Kv) channel pore-forming alpha subunits. Functions as an inhibitory beta-subunit of the repolarizing cardiac potassium ion channel KCNQ1.

Belongs to the potassium channel KCNE family.

14.968 kDa

MNCSESQRLQTLLNRLLLELHHRGNASGLGIGTGPSMGMGVVPDPFVGREATSAKGNDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPPLACVAEQEWVPAAIASADPENGQGLLAEGGHQLAAGALPALAQGAERV

KCNE5

Potassium voltage-gated channel subfamily E regulatory beta subunit 5

142 amino acids

Potassium channel ancillary subunit that is essential for generation of some native K(+) currents by virtue of formation of heteromeric ion channel complex with voltage-gated potassium (Kv) channel pore-forming alpha subunits. Functions as an inhibitory beta-subunit of the repolarizing cardiac potassium ion channel KCNQ1.

Belongs to the potassium channel KCNE family.

14.993 kDa

MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAERV