Protein expression services for Kcne5 | Potassium voltage-gated channel subfamily E regulatory beta subunit 5
Description
Potassium channel ancillary subunit that is essential for generation of some native K(+) currents by virtue of formation of heteromeric ion channel complex with voltage-gated potassium (Kv) channel pore-forming alpha subunits. Functions as an inhibitory beta-subunit of the repolarizing cardiac potassium ion channel KCNQ1.
Family
Belongs to the potassium channel KCNE family.
Species
Mus musculus
Length
143 amino acids
Sequence
MNCSESQRLQTLLNRLLLELHHRGNASGLGIGTGPSMGMGVVPDPFVGREATSAKGNDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPPLACVAEQEWVPAAIASADPENGQGLLAEGGHQLAAGALPALAQGAERV
Mass
15 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Kcne5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here