IGFBP1

Insulin-like growth factor-binding protein 1

272 amino acids

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).

29.814 kDa

MPEVPAAGLWPFLLLLAVQVSTVASSTQPWHCAPCSAEKLALCPPVPSSCPELSRPAGCGCCPMCALPLGAACGVATARYARGLSCRALPGEPRPLHALTRGQGACVPEPATPTASGLSSIEKEEAKASMVPERVPPESAEMTEEQLLESFHLMASSSEDQPILWNAISTYKSMRAREMADIKKWKQPCRRELYKVLERLAKAQQKAGEEIYKFYLPNCNKNGFYHSKQCETSLDGEAELCWCVYPWSGRRIPGSLEIRGDPNCHQYFNVQN

Igfbp1

Insulin-like growth factor-binding protein 1

272 amino acids

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).

29.57 kDa

MPEFLTVVSWPFLILLSFQIGVAAGAPQPWHCAPCTAERLGLCPPVPASCPEISRPAGCGCCPTCALPMGAACGVATARCAQGLSCRALPGEPRPLHALTRGQGACVPEPAAPATSTLFSSQHEEAKAAVVSADELSESPEMTEEQLLDSFHLMAPSREDQPILWNAISTYSSMRAREIADLKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCNKNGFYHSKQCETSLDGEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNVHN

Igfbp1

Insulin-like growth factor-binding protein 1

272 amino acids

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).

29.684 kDa

MPEFLTVVSWPFLILLSFQVRVVAGAPQPWHCAPCTAERLELCPPVPASCPEISRPAGCGCCPTCALPLGAACGVATARCAQGLSCRALPGEPRPLHALTRGQGACVLEPAAPATSSLSGSQHEEAKAAVASEDELAESPEMTEEQLLDSFHLMAPSREDQPILWNAISTYSSMRAREITDLKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCNKNGFYHSKQCETSLDGEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNVQN

IGFBP1

Insulin-like growth factor-binding protein 1

263 amino acids

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).

28.794 kDa

MPEVLAVRAWPLLLSLAVQLGATVGAPQPWRCAPCSAERMALCPPVPASCPELTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEPRPLHALTRGQGACMTTPSDEATDTKDTTSPENVSPESSEITQEQLLDNFHLMAESSEDLPILWNAISNYESLRALEISDVKKWKEPCQRELYKVLDRLAREQQKAGDKLYKFYLPNCNKNGFYHSKQCETSLEGEPGLCWCVYPWSGKRILGSVAVRGDPKCQQYFNLQN

IGFBP1

Insulin-like growth factor-binding protein 1

262 amino acids

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).

28.331 kDa

MPEVPAVRAWPLLLSLALQLGAAAGAPQPLHCAPCSAERLALCPPVPASCPEATRPAGCGCCPTCALPLGACGVATARCARGLSCRALPGEPRPLHALTRGQGACMPAPSAEATETKDPAAPETTSPESTEMTQEQLLDSFHLMATSSEDLPILWNAINNYESMKALEATDIKKWKEPCQRELYKVLDRLAREQQKAGDRLYKFYLPNCNKNGFYHSKQCETSLEGEPGLCWCVYPWSGKKILGSTAVRGDPKCHQYFNSQN

IGFBP1

Insulin-like growth factor-binding protein 1

259 amino acids

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.

27.904 kDa

MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN