About Products Protein Database Contact

Protein expression services for IGFBP1 | Insulin-like growth factor-binding protein 1

Description
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).
Species
Bos taurus
Length
263 amino acids
Sequence
MPEVLAVRAWPLLLSLAVQLGATVGAPQPWRCAPCSAERMALCPPVPASCPELTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEPRPLHALTRGQGACMTTPSDEATDTKDTTSPENVSPESSEITQEQLLDNFHLMAESSEDLPILWNAISNYESLRALEISDVKKWKEPCQRELYKVLDRLAREQQKAGDKLYKFYLPNCNKNGFYHSKQCETSLEGEPGLCWCVYPWSGKRILGSVAVRGDPKCQQYFNLQN
Mass
28.8 kDa
Simulated SDS-PAGE
Western blot of IGFBP1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make IGFBP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here