GRAMD2A

GRAM domain-containing protein 2A

354 amino acids

Participates in the organization of endoplasmic reticulum-plasma membrane contact sites (EPCS) with pleiotropic functions including STIM1 recruitment and calcium homeostasis. Constitutive tether that co-localize with ESYT2/3 tethers at endoplasmic reticulum-plasma membrane contact sites in a phosphatidylinositol lipid-dependent manner. Pre-marks the subset of phosphtidylinositol 4,5-biphosphate (PI(4,5)P2)-enriched EPCS destined for the store operated calcium entry pathway (SOCE).

40.249 kDa

MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKCGREGITLNKYNQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFGKDIKVVIPVVSVQMIKKHKMARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNIPCIPPSSVDSTDSFFPSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYEEDELEEEPRSTGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPVPGHR

Gramd2a

GRAM domain-containing protein 2A

320 amino acids

Participates in the organization ofendoplasmic reticulum-plasma membrane contact sites (EPCS) with pleiotropic functions including STIM1 recruitment and calcium homeostasis. Constitutive tether that co-localize with ESYT2/3 tethers at endoplasmic reticulum-plasma membrane contact sites in a phosphatidylinositol lipid-dependent manner. Pre-marks the subset of phosphtidylinositol 4,5-biphosphate (PI(4,5)P2)-enriched EPCS destined for the store operated calcium entry pathway (SOCE).

36.441 kDa

MQMKMMFFCLSDWQSNQQMHGKMAPLKSHVPCTEKPGKVQEPPDDGSLHWSEGSKGEDIKKYSREGTLRSKYNQQYHKLFKDIPLEEVVLKVCSCALQRDLLLHGRLYISPNWLCFHASLFGKDIKVVIPVVSVQLIKKHKMARLLPNGLAITTNTSQKYVFVSLLSRDSVYDMLRRVCTHLQPSSKKSLSIRKFPEEAECESPEVLIPEMKWRKACSAPASLSLPDSISCISQIPTDSTDSCFPSRKPPGSEAVCEKDALEEEPSTDQELRLWDSRLLKVIFVMICFLVLSSSYLAFRISRLEQQLCSLSWGSPLPRDR