Participates in the organization ofendoplasmic reticulum-plasma membrane contact sites (EPCS) with pleiotropic functions including STIM1 recruitment and calcium homeostasis. Constitutive tether that co-localize with ESYT2/3 tethers at endoplasmic reticulum-plasma membrane contact sites in a phosphatidylinositol lipid-dependent manner. Pre-marks the subset of phosphtidylinositol 4,5-biphosphate (PI(4,5)P2)-enriched EPCS destined for the store operated calcium entry pathway (SOCE).

320 amino acids

MQMKMMFFCLSDWQSNQQMHGKMAPLKSHVPCTEKPGKVQEPPDDGSLHWSEGSKGEDIKKYSREGTLRSKYNQQYHKLFKDIPLEEVVLKVCSCALQRDLLLHGRLYISPNWLCFHASLFGKDIKVVIPVVSVQLIKKHKMARLLPNGLAITTNTSQKYVFVSLLSRDSVYDMLRRVCTHLQPSSKKSLSIRKFPEEAECESPEVLIPEMKWRKACSAPASLSLPDSISCISQIPTDSTDSCFPSRKPPGSEAVCEKDALEEEPSTDQELRLWDSRLLKVIFVMICFLVLSSSYLAFRISRLEQQLCSLSWGSPLPRDR

36.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Gramd2a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here