GPI19

Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI19

153 amino acids

Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Involved in cell wall biosynthesis (By similarity).

Belongs to the GPI19 family.

17.597 kDa

MKQDKRKYSGFVQSVGITCVLILIILWTLLPYPLLDPEKRLAEPQTTTESISLFLDELVELFPQRYWIICIQCMILMDMLFVYIGLPIFNQSVLTVRLDDLRTITDSKASVVMCESHAEFLTSYAHTETSGVYDLPITEVSRLLYGKARHKSD

GPI19

Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI19

140 amino acids

Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Involved in cell wall biosynthesis.

Belongs to the GPI19 family.

16.09 kDa

MYTKEYYWFSQYMIITSTLVLTIIWSILPSSLGEAAPKQFINTLLDIFPQRRWIITLESIMLMGMLCTYIGLLMYNEDTLTPPLDSLSTVTDAGGQLVIEDDPDVFVKKWAFKETSGIYDLSLMDACQLLYLYDNDHTST