Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Involved in cell wall biosynthesis.

Belongs to the GPI19 family.

140 amino acids

MYTKEYYWFSQYMIITSTLVLTIIWSILPSSLGEAAPKQFINTLLDIFPQRRWIITLESIMLMGMLCTYIGLLMYNEDTLTPPLDSLSTVTDAGGQLVIEDDPDVFVKKWAFKETSGIYDLSLMDACQLLYLYDNDHTST

16.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GPI19 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here