Glrx3

Glutaredoxin-3

337 amino acids

Together with BOLA2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins (By similarity). Acts as a critical negative regulator of cardiac hypertrophy and a positive inotropic regulator (PubMed:16809552, PubMed:18258855, PubMed:18929570). Required for hemoglobin maturation. Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity (By similarity).

37.778 kDa

MAAGAAEAGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFPPSTNEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKGEN

Glrx3

Glutaredoxin-3

337 amino acids

Together with BOLA2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins (By similarity). Acts as a critical negative regulator of cardiac hypertrophy and a positive inotropic regulator (PubMed:16809552, PubMed:18258855). Required for hemoglobin maturation (By similarity). Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity (By similarity).

37.849 kDa

MAAGAAEAAEAAVAVVEVGSARQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGSFPPSTNEHVKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKGEN

GLRX3

Glutaredoxin-3

335 amino acids

Together with BOLA2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins (PubMed:26613676, PubMed:27519415). Acts as a critical negative regulator of cardiac hypertrophy and a positive inotropic regulator (By similarity). Required for hemoglobin maturation (PubMed:23615448). Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.

37.432 kDa

MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

GLRX3

Glutaredoxin-3

334 amino acids

Together with BOLA2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins (By similarity). Acts as a critical negative regulator of cardiac hypertrophy and a positive inotropic regulator (By similarity). Required for hemoglobin maturation. Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity (By similarity).

37.298 kDa

MAGGAAEAAAAVVEVGSSGQFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHQQVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFSPSGSEHPKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSSWPTYPQLYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSRQILEILNSTGIEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILKGEN

glrx3

Glutaredoxin-3

326 amino acids

Together with bola2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins. Required for hemoglobin maturation. Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.

36.424 kDa

MAAVLEAGSAGQFEQLIQNSAKSLTVVHFWAPWAPQCTQMNEVMAELAKEQPQVMFVKLEAEAVPEVSEKYEVTSVPTFLFFKNSQKIDRLDGAHAPELTKRVQRHASSTSFPATPNSAPKEDLNGRLKKLINAAPCMLFMKGSPQEPRCGFSRQIVALLNDQKVQFSSFDILSDEEVRQGLKTFSNWPTYPQFYVKGELVGGLDIVKEMVASGELDQMCPKAQSLEERLKALVNKAPVMLFMKGNKEMAKCGFSRQILEIMNNTGVTYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIIKELKESGELVSVLKGDQ

glrx3

Glutaredoxin 3

326 amino acids

Together with bola2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins (By similarity). Required for hemoglobin maturation (PubMed:23615448). Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity (By similarity).

36.335 kDa

MANFTDAASLQQFDELLKNNSKSLTVVHFHAPWAPQCSQMNDVMAELAKEHKHTMFVKLEAEAVPEVSEKYEITSVPTFLFFKGGEKIDRLDGAHAPELTNKVQRLGSGGGGAVGAGDVPKEDLNQRLKRLINAAPCMLFMKGSPQEPRCGFSRQIIQILKDHNVQYSSFDILSDEEVRQGLKTYSNWPTYPQVYVSGELIGGLDIVKELVESGELENTFPKTVSLENRLKSLINKSPVMLFMKGNKEAAKCGFSRQILEIMNNTGVEYDTFDILEDEEVRQGLKTYSNWPTFPQLYVKGDLIGGLDIVKELLEGGELVSVLKGEN

glrx3

Glutaredoxin-3 homolog

240 amino acids

Crucial regulator of cellular iron homeostasis. May play a role in regulating the function of the thioredoxin system. Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity (By similarity).

27.479 kDa

MANTINTNEEFENILKDNKFLVVMFWADWSKPSTQMRDVFDQLAKQATNQANNKLLFLKVEAEKVHQISGRYNVKSVPTCIFLNQGKLVQSVVGANPSELALQTNNFSKTCDTLPLEEQQQQQQSEEIINKIKLDQEQEKKLLNERLEKLVNQSPVMLFMKGNPEKPQCGFSNKTVTILKENGFEFGSFDILQDQAVRNGLKEYSNWPTYPQLYINGKLVGGYDIIKDLNEEGELIDLKP